#. extracted from helpcontent2/source/text/shared/guide msgid "" msgstr "" "Project-Id-Version: PACKAGE VERSION\n" "Report-Msgid-Bugs-To: https://bugs.libreoffice.org/enter_bug.cgi?product=LibreOffice&bug_status=UNCONFIRMED&component=UI\n" "POT-Creation-Date: 2015-01-07 11:07+0100\n" "PO-Revision-Date: 2015-02-28 15:04+0000\n" "Last-Translator: Kolbjørn \n" "Language-Team: LANGUAGE \n" "Language: nn\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=utf-8\n" "Content-Transfer-Encoding: 8bit\n" "Plural-Forms: nplurals=2; plural=(n != 1);\n" "X-Generator: Pootle 2.5.1\n" "X-Accelerator-Marker: ~\n" "X-POOTLE-MTIME: 1425135858.000000\n" #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "tit\n" "help.text" msgid "First Steps" msgstr "Dei første stega" #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "bm_id3156324\n" "help.text" msgid "samples and templatestemplates; new documents from templatesbusiness cards; using templates" msgstr "døme og malarmalar; nye dokument frå malarvisittkort; bruka malar" #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "hd_id3156324\n" "1\n" "help.text" msgid "First Steps" msgstr "Dei første stega" #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "hd_id3156211\n" "2\n" "help.text" msgid "How to simplify your work using samples and templates" msgstr "Bruka døme og malar til å forenkla arbeidet" #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "par_id3144436\n" "3\n" "help.text" msgid "%PRODUCTNAME includes many sample documents and ready-to-use templates. You can access these by choosing File - New - Templates, or press Shift+CommandCtrl+N." msgstr "I %PRODUCTNAME finst det mange eksempeldokument og malar som kan brukast direkte. Du får tilgang til desse ved å velja Filer → Ny → Malar eller ved å trykke Skift+CmdCtrl + N." #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "par_id3147291\n" "4\n" "help.text" msgid "When you open one of the templates, a new document is created based on this template." msgstr "Når du opnar ein av malane vert det laga eit nytt dokument basert på denne malen." #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "par_id0820200803563860\n" "help.text" msgid "Click the Get more templates online link in the dialog to select and download more templates." msgstr "Trykk Få fleire malar på nett-lenkja i dialogvindauget for å velja og lasta ned fleire." #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "par_id0820200803563974\n" "help.text" msgid "You can also use the various wizards (under the File - Wizards menu) to create your own templates, which you can use as a basis for further documents." msgstr "Du kan også bruka dei ulike vegvisarane (i hovudmenyen under Fil → Vegvisar) for å laga dine eigne malar som kan brukast som grunnlag for malar brukte i andre dokument." #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "par_id3149177\n" "6\n" "help.text" msgid "Working with %PRODUCTNAME" msgstr "Arbeida med %PRODUCTNAME" #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "par_id3149095\n" "7\n" "help.text" msgid "Working with Text Documents" msgstr "Arbeida med tekstdokument" #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "par_id3152997\n" "8\n" "help.text" msgid "Working with Spreadsheets" msgstr "Arbeida med rekneark" #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "par_id3147243\n" "9\n" "help.text" msgid "Working with Presentations" msgstr "Arbeida med presentasjonar" #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "par_id3154047\n" "10\n" "help.text" msgid "Working with Drawings" msgstr "Arbeida med teikningar" #: aaa_start.xhp msgctxt "" "aaa_start.xhp\n" "par_id3153824\n" "11\n" "help.text" msgid "Working with Formulas" msgstr "Arbeida med formlar" #: accessibility.xhp msgctxt "" "accessibility.xhp\n" "tit\n" "help.text" msgid "Accessibility in %PRODUCTNAME" msgstr "Tilgjenge i %PRODUCTNAME" #: accessibility.xhp msgctxt "" "accessibility.xhp\n" "bm_id3150502\n" "help.text" msgid "accessibility; %PRODUCTNAME features" msgstr "tilgjenge; %PRODUCTNAME-eigenskapar" #: accessibility.xhp msgctxt "" "accessibility.xhp\n" "hd_id3150502\n" "7\n" "help.text" msgid "Accessibility in %PRODUCTNAME" msgstr "Tilgjenge i %PRODUCTNAME" #: accessibility.xhp msgctxt "" "accessibility.xhp\n" "par_id3154894\n" "6\n" "help.text" msgid "The following accessibility features are part of %PRODUCTNAME:" msgstr "Desse funksjonane for tilgjenge er ein del av %PRODUCTNAME:" #: accessibility.xhp msgctxt "" "accessibility.xhp\n" "par_id3153894\n" "5\n" "help.text" msgid "Support of external devices and applications" msgstr "Støtte for eksterne einingar og program" #: accessibility.xhp msgctxt "" "accessibility.xhp\n" "par_id3155552\n" "4\n" "help.text" msgid "Access to all functions by keyboard. The keys that replace the mouse actions are listed in the %PRODUCTNAME Help" msgstr "Tilgang til alle funksjonar frå tastaturet. Tastane som erstattar dei ulike musehandlingane er lista i «Hjelp» for %PRODUCTNAME" #: accessibility.xhp msgctxt "" "accessibility.xhp\n" "par_id3149177\n" "3\n" "help.text" msgid "Improved readability of screen contents" msgstr "Betre lesing av skjermen" #: accessibility.xhp msgctxt "" "accessibility.xhp\n" "par_id3146957\n" "8\n" "help.text" msgid "Zooming of on-screen user interface for menus, icons, and documents" msgstr "Menyar, knappar og dokument på skjermen kan skalerast" #: accessibility.xhp msgctxt "" "accessibility.xhp\n" "par_id3145071\n" "12\n" "help.text" msgid "The user interface is scalable through your Window Manageroperating system settings. The default font size for dialogs is 12pt, corresponding to a scale of 100%. You can also change the font size for dialogs in %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME - View. The zoom factor of a document can be changed in View - Zoom, or by double-clicking the zoom factor displayed in the Status Bar." msgstr "Brukargrensesnittet kan skalerast med innstillingane i vindaugehandteriungssystemetoperativsystemet. Standard skriftstorleik for dialogar er 12pt, som svarar til ein målestokk på 100%. Du kan også endra skriftstorleiken for dialogar i %PRODUCTNAME → InnstillingarVerktøy → Innstillingar%PRODUCTNAME → Vis. Skaleringa av eit dokument kan endrast i Vis → Skalering eller ved å dobbeltklikka på skaleringa som vert vist i statuslinja." #: accessibility.xhp msgctxt "" "accessibility.xhp\n" "par_id3152349\n" "2\n" "help.text" msgid "Please note that accessibility support relies on Java technology for communications with assistive technology tools. This means that the first program startup may take a few seconds longer, because the Java runtime environment has to be started as well." msgstr "Legg merke til at støtte for tilgjenge brukar Java-teknologi for å kommunisera med hjelpeprogram for brukarar med funksjonshindringar. Dette betyr at oppstarten av programmet kan ta nokre få sekund ekstra fordi JRE (Java Runtime Environment) først må aktiverast." #: accessibility.xhp msgctxt "" "accessibility.xhp\n" "par_id3149578\n" "9\n" "help.text" msgid "%PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME - View" msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Vis" #: accessibility.xhp msgctxt "" "accessibility.xhp\n" "par_id3150084\n" "10\n" "help.text" msgid "%PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME - Appearance" msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Utsjånad" #: accessibility.xhp msgctxt "" "accessibility.xhp\n" "par_id3150771\n" "11\n" "help.text" msgid "%PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME - Accessibility" msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Tilgjenge" #: active_help_on_off.xhp msgctxt "" "active_help_on_off.xhp\n" "tit\n" "help.text" msgid "Turning Extended Tips On and Off" msgstr "Slå av og på utvida tips" #: active_help_on_off.xhp msgctxt "" "active_help_on_off.xhp\n" "bm_id3156414\n" "help.text" msgid "Help; extended tips on/offextended tips in Helptips;extended tips in Helptooltips;extended tipsactivating;extended help tips" msgstr "Hjelp; utvida tips på/avutvida tips i «Hjelp»tips;utvida tips i «Hjelp»verktøytips;utvida tipsslå på;utvida tips i «Hjelp»" #: active_help_on_off.xhp msgctxt "" "active_help_on_off.xhp\n" "hd_id3156414\n" "1\n" "help.text" msgid "Turning Extended Tips On and Off" msgstr "Slå av og på utvida tips" #: active_help_on_off.xhp msgctxt "" "active_help_on_off.xhp\n" "par_id3157958\n" "2\n" "help.text" msgid "Extended tips provide a brief description of the function of a particular icon, text box or menu command when you rest your cursor on that item." msgstr "Utvida tips gir ei kort forklaring på funksjonen til eit ikon, eit tekstfelt eller ein menykommando når musepeikaren vert halde over elementet." #: active_help_on_off.xhp msgctxt "" "active_help_on_off.xhp\n" "hd_id3155339\n" "3\n" "help.text" msgid "To turn Extended Tips on and off:" msgstr "Slik slår du av og på utvida tips:" #: active_help_on_off.xhp msgctxt "" "active_help_on_off.xhp\n" "par_id3154823\n" "4\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME - General, and check Extended tips." msgstr "Vis Verktøy → Innstillingar → $[officename]." #: active_help_on_off.xhp msgctxt "" "active_help_on_off.xhp\n" "par_id3149398\n" "5\n" "help.text" msgid "A check mark indicates that the extended tips are activated." msgstr "Eit merke i denne boksen indikerer at utvida tips slått på." #: active_help_on_off.xhp msgctxt "" "active_help_on_off.xhp\n" "hd_id3149811\n" "6\n" "help.text" msgid "To turn Extended Tips on temporarily:" msgstr "Lik kan du slå på utvida tips mellombels:" #: active_help_on_off.xhp msgctxt "" "active_help_on_off.xhp\n" "par_id3153541\n" "7\n" "help.text" msgid "Press the shortcut keys Shift+F1 to activate extended tips once." msgstr "Trykk snartastane Shift + F1 for å slå på utvida tips éi gong." #: active_help_on_off.xhp msgctxt "" "active_help_on_off.xhp\n" "par_id3153825\n" "8\n" "help.text" msgid "A question mark appears beside the mouse pointer. You can move this Help Mouse Pointer over all controls, icons and menu commands to obtain a description of the command. The Help Mouse Pointer is disabled the next time you click the mouse." msgstr "Du får opp eit spørjeteikne ved sida av musepeikaren. Du kan flytte denne Hjelp - musepeikar over alle kontrollelement, knappar og menykommandoar for å få opp ein omtale av kommandoen. Hjelp - musepeikar vert slått av neste gong du klikkar med musa." #: activex.xhp msgctxt "" "activex.xhp\n" "tit\n" "help.text" msgid "ActiveX Control to Display Documents in Internet Explorer" msgstr "ActiveX-kontroll for å visa dokument i Internet Explorer" #: activex.xhp msgctxt "" "activex.xhp\n" "bm_id3143267\n" "help.text" msgid "ActiveX controlinstalling;ActiveX controlInternet; Internet Explorer for displaying $[officename] documents$[officename] documents;viewing and editing in Internet Explorerviewing;%PRODUCTNAME documents in Internet Explorerediting;%PRODUCTNAME documents in Internet Explorer" msgstr "ActiveX-kontrollinnstalere;ActiveX-kontrollInternett; Internet Explorer for vising av $[officename]-dokument$[officename] dokument;visa og redigera i Internet Explorervisa;%PRODUCTNAME-dokument i Internet Explorerredigera;%PRODUCTNAME-dokument i Internet Explorer" #: activex.xhp msgctxt "" "activex.xhp\n" "hd_id3143267\n" "1\n" "help.text" msgid "ActiveX Control to Display Documents in Internet Explorer" msgstr "ActiveX-kontroll for å visa dokument i Internet Explorer" #: activex.xhp msgctxt "" "activex.xhp\n" "par_id3166410\n" "2\n" "help.text" msgid "Under Windows only, you can view any $[officename] document in a window of the Microsoft Internet Explorer. Install the ActiveX control in the $[officename] Setup program." msgstr "I Windows kan du visa alle $[officename]-dokumenta i eit i Microsoft Internet Explorer-vindauge. Bruk installasjonsprogrammet for $[officename] for å installera ActiveX-kontrollen." #: activex.xhp msgctxt "" "activex.xhp\n" "hd_id3156346\n" "3\n" "help.text" msgid "Installing the ActiveX control" msgstr "Slik installerer du ActiveX-kontrollen" #: activex.xhp msgctxt "" "activex.xhp\n" "par_id3153821\n" "4\n" "help.text" msgid "Close $[officename] and the Quickstarter." msgstr "Lukk $[officename] og snøggstartaren." #: activex.xhp msgctxt "" "activex.xhp\n" "par_id3150771\n" "5\n" "help.text" msgid "Click the Start button on the Windows taskbar. Choose Control Panel." msgstr "Klikk på startknappen i Windows og vel Kontrollpanel." #: activex.xhp msgctxt "" "activex.xhp\n" "par_idN106E8\n" "help.text" msgid "In the Control Panel, click Add or Remove Programs." msgstr "Trykk på Legg til / fjern programmer i kontrollpanelet." #: activex.xhp msgctxt "" "activex.xhp\n" "par_id3156155\n" "6\n" "help.text" msgid "In the list, click %PRODUCTNAME, then click Change." msgstr "Vel %PRODUCTNAME i lista og trykk på Endre." #: activex.xhp msgctxt "" "activex.xhp\n" "par_idN10706\n" "help.text" msgid "In the Installation Wizard, select Modify." msgstr "Vel Endre i installasjonsvegvisaren." #: activex.xhp msgctxt "" "activex.xhp\n" "par_id3159399\n" "7\n" "help.text" msgid "Open the Optional Components entry and find the ActiveX Control entry. Open the sub menu of the icon and select to install the feature." msgstr "Opna oppføringa Valgfrie komponenter og finn oppføringa ActiveX-kontroll. Trykk på ikonet for å opna undermenyen, og vel å installere funksjonen." #: activex.xhp msgctxt "" "activex.xhp\n" "par_id3153561\n" "8\n" "help.text" msgid "Click Next and Install." msgstr "Trykk Neste og Installer." #: activex.xhp msgctxt "" "activex.xhp\n" "hd_id3151384\n" "9\n" "help.text" msgid "Viewing $[officename] documents" msgstr "Visa $[officename]-dokument" #: activex.xhp msgctxt "" "activex.xhp\n" "par_id3149669\n" "10\n" "help.text" msgid "In Internet Explorer, browse to a web page that contains a link to a $[officename] Writer document, for example." msgstr "I Internet Explorer kan du gå til ei nettside som inneheld ei lenkje til eit $[officename]-dokument, for eksempel eit Writer-dokument." #: activex.xhp msgctxt "" "activex.xhp\n" "par_id3148550\n" "11\n" "help.text" msgid "Click the link to view the document in the Internet Explorer window." msgstr "Trykk på lenkja for å visa dokumentet i Internet Explorer-vindauget." #: activex.xhp msgctxt "" "activex.xhp\n" "par_id3154072\n" "12\n" "help.text" msgid "You may still right-click the link to save the file on your harddisk." msgstr "Du kan framleis høgreklikka på lenkja for å lagra fila på harddisken." #: activex.xhp msgctxt "" "activex.xhp\n" "hd_id3153361\n" "13\n" "help.text" msgid "Editing $[officename] documents" msgstr "Redigera $[officename]-dokument" #: activex.xhp msgctxt "" "activex.xhp\n" "par_id3154367\n" "14\n" "help.text" msgid "The $[officename] document inside the Internet Explorer shows a set of read-only toolbar icons." msgstr "$[officename]-dokumentet som vert vist i Internet Explorer viser eit sett med skriveverna verktøylinjeknappar." #: activex.xhp msgctxt "" "activex.xhp\n" "par_id3148451\n" "15\n" "help.text" msgid "Click the Edit file icon in the document's toolbar to open a copy of the document in a new $[officename] window." msgstr "Trykk på Rediger fil i verktøylinja til dokument for å opna ein kopi av dokumentet i eit nytt $[officename]-vindauge." #: activex.xhp msgctxt "" "activex.xhp\n" "par_id3144760\n" "16\n" "help.text" msgid "Edit the copy of the document." msgstr "Rediger kopien av dokumentet." #: assistive.xhp msgctxt "" "assistive.xhp\n" "tit\n" "help.text" msgid "Assistive Tools in $[officename]" msgstr "Hjelpeverktøy i $[officename]" #: assistive.xhp msgctxt "" "assistive.xhp\n" "bm_id3147399\n" "help.text" msgid "accessibility; $[officename] assistive technologyassistive technology in $[officename]screen readersscreen magnifiersmagnifiers" msgstr "tilgjenge; tilgjengeteknologi i $[officename]tilgjengeteknologi i $[officename]skjermlesararskjermforstørringarforstørring" #: assistive.xhp msgctxt "" "assistive.xhp\n" "hd_id3147399\n" "22\n" "help.text" msgid "Assistive Tools in $[officename]" msgstr "Hjelpeverktøy i $[officename]" #: assistive.xhp msgctxt "" "assistive.xhp\n" "par_id3143267\n" "25\n" "help.text" msgid "$[officename] supports some assistive technology tools like screen magnification software, screen readers, and on-screen keyboards." msgstr "$[officename] har støtte for ein del hjelpeverktøy som skjermforstørring, skjermlesarar og skjermtastatur." #: assistive.xhp msgctxt "" "assistive.xhp\n" "par_id8847010\n" "help.text" msgid "A current list of supported assistive tools can be found on the Wiki at http://wiki.documentfoundation.org/Accessibility." msgstr "Du kan finna ei liste over støtta tilgjengeprogram i Wikien på http://wiki.documentfoundation.org/Accessibility." #: assistive.xhp msgctxt "" "assistive.xhp\n" "hd_id3153061\n" "24\n" "help.text" msgid "Supported Input Devices" msgstr "Støtta inndataeiningar" #: assistive.xhp msgctxt "" "assistive.xhp\n" "par_id3156024\n" "7\n" "help.text" msgid "$[officename] provides the ability to use alternative input devices for access to all functions of $[officename]." msgstr "I $[officename] kan du bruka alternative inndataeiningar for å få tilgang til alle funksjonane i $[officename]." #: assistive.xhp msgctxt "" "assistive.xhp\n" "par_id3149045\n" "8\n" "help.text" msgid "Screen magnification software allow users with low vision to work in $[officename] with caret and focus tracking." msgstr "Skjermforstørringa gjer at brukarar med nedsett syn kan arbeida i $[officename] med sporing av innsettingspunkt og fokus." #: assistive.xhp msgctxt "" "assistive.xhp\n" "par_id3152811\n" "9\n" "help.text" msgid "On-screen keyboards enable users to perform almost all data input and commands with a mouse." msgstr "Med skjermtastaturet kan brukarane skriva inn det meste av data og kommandoar ved å bruke musa." #: assistive.xhp msgctxt "" "assistive.xhp\n" "par_id3153379\n" "10\n" "help.text" msgid "Screen readers allow visually impaired users to access $[officename] with text-to-speech and Braille displays." msgstr "Med skjermlesarane kan menneske med synshemningar bruka $[officename] ved hjelp av talesyntese og leselist." #: assistive.xhp msgctxt "" "assistive.xhp\n" "par_id3152933\n" "18\n" "help.text" msgid "%PRODUCTNAME - PreferencesTools - Options - $[officename] - View" msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Vis" #: assistive.xhp msgctxt "" "assistive.xhp\n" "par_id3155430\n" "19\n" "help.text" msgid "%PRODUCTNAME - PreferencesTools - Options - $[officename] - Appearance" msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Utsjånad" #: assistive.xhp msgctxt "" "assistive.xhp\n" "par_id3148617\n" "20\n" "help.text" msgid "%PRODUCTNAME - PreferencesTools - Options - $[officename] - Accessibility" msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Utsjånad" #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "tit\n" "help.text" msgid "Turning off Automatic URL Recognition" msgstr "Slå av automatisk URL-gjenkjenning" #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "bm_id3149346\n" "help.text" msgid "AutoCorrect function; URL recognition recognizing URLs automatically automatic hyperlink formatting URL;turning off URL recognition hyperlinks;turning off automatic recognition links;turning off automatic recognition predictive text, see also AutoCorrect function/AutoFill function/AutoInput function/word completion/text completion" msgstr "Autoretting-funksjon; URL-gjenkjenning gjenkjenne URL-ar automatisk automatisk hyperlenkjeformatering URL;slå av URL-gjenkjenning hyperlenkjer;slå av automatisk gjenkjenning lenkjer;slå av automatisk gjenkjenning prediktiv tekst, sjå også autoretting/autofyll/autoinnsetting/fullføring av/fullføring av tekst" #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "hd_id3149346\n" "6\n" "help.text" msgid "Turning off Automatic URL Recognition" msgstr "Slå av automatisk URL-gjenkjenning" #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "par_id3166410\n" "7\n" "help.text" msgid "When you enter text, $[officename] automatically recognizes a word that may be a URL and replaces the word with a hyperlink. $[officename] formats the hyperlink with direct font attributes (color and underline) the properties of which are obtained from certain Character Styles." msgstr "Når du skriv inn tekst, kjenner $[officename] automatisk igjen ord som kan vera ein URL og byter ut ordet med ei hyperlenkje. $[officename] formaterer hyperlenkja med direkte skriftattributt (farge og understreking). Skriftattributta vert henta frå teiknsettet." #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "par_id3153561\n" "2\n" "help.text" msgid "If you do not want $[officename] to automatically recognize URLs as you are typing, there are several ways of turning off this feature." msgstr "Viss du ikkje vil at $[officename] skal kjenna igjen URL-ar automatisk når du skriv dei inn, kan du slå av denne funksjonen på fleire måtar." #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "hd_id3154306\n" "8\n" "help.text" msgid "Undo URL Recognition" msgstr "Angra URL-gjenkjenning" #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "par_id3149233\n" "3\n" "help.text" msgid "When you are typing and notice that a text has just been automatically converted into a hyperlink, press CommandCtrl+Z to undo this formatting." msgstr "Når du skriv inn tekst og legg merke til at han er gjort om til ei hyperlenkje, kan du trykka Cmd Ctrl + Z for å angra denne formateringa." #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "par_id3149235\n" "4\n" "help.text" msgid "If you do not notice this conversion until later, select the hyperlink, open the context menu and choose Remove Hyperlink." msgstr "Vel ei linje som vart oppretta ved at to eller fleire linjer vart kopla saman, opna sprettoppmenyen og vel Kopla frå." #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "hd_id3152350\n" "9\n" "help.text" msgid "Turn off URL Recognition" msgstr "Slå av URL-gjenkjenning" #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "par_id3149514\n" "10\n" "help.text" msgid "Load a document of the type for which you want to modify the URL recognition." msgstr "Opna eit dokument som du vil endra URL-gjenkjenning for." #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "par_id3151246\n" "11\n" "help.text" msgid "If you want to modify the URL recognition for text documents, open a text document." msgstr "Viss du vil endra URL-gjenkjenning i tekstdokument, opnar du eit tekstdokument." #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "par_id3159413\n" "12\n" "help.text" msgid "Choose Tools - AutoCorrect Options." msgstr "Vel Verktøy → Innstillingar for autoretting." #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "par_id3148550\n" "13\n" "help.text" msgid "In the AutoCorrect dialog, select the Options tab." msgstr "I dialogvindauget Autoretting vel du fana Val." #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "par_id3153360\n" "14\n" "help.text" msgid "If you unmark URL Recognition, words will no longer be automatically replaced with hyperlinks." msgstr "Viss du vel bort URL-gjenkjenning, vert ord ikkje lenger automatisk erstatta med hyperlenkjer." #: autocorr_url.xhp msgctxt "" "autocorr_url.xhp\n" "par_id3156423\n" "15\n" "help.text" msgid "In $[officename] Writer there are two check boxes in front of URL Recognition. The box in the first column is for later post-editing and the box in the second column is for AutoCorrect as you type." msgstr "I $[officename] Writer er det to avkryssingsbokser framføre URL-gjenkjenning. Boksen i den første kolonnen er for etterredigering og den andre gjeld autoretting medan du skriv." #: autohide.xhp msgctxt "" "autohide.xhp\n" "tit\n" "help.text" msgid "Showing, Docking and Hiding Windows" msgstr "Visa, festa og gøyma vindauge" #: autohide.xhp msgctxt "" "autohide.xhp\n" "bm_id3150713\n" "help.text" msgid "Gallery; hiding/showingdata source view; showingNavigator; dockingStyles and Formatting window; dockingwindows; hiding/showing/dockingdocking; windowsundocking windowsshowing;docked windowshiding;docked windows" msgstr "galleriet; gøyma/visadatakjeldevising; visadokumentstruktur; festastilhandsamar; festavindauge; gøyma/visa/festafesta; vindaugelosna vindaugevisa;festa vindaugegøyma;festa vindauge" #: autohide.xhp msgctxt "" "autohide.xhp\n" "hd_id3145346\n" "71\n" "help.text" msgid "Showing, Docking and Hiding Windows" msgstr "Visa, festa og gøyma vindauge " #: autohide.xhp msgctxt "" "autohide.xhp\n" "par_id3147242\n" "52\n" "help.text" msgid "Some windows in $[officename] are dockable, such as the Navigator window. You can move these windows, re-size them or dock them to an edge." msgstr "Nokre av vindauga i $[officename], for eksempel «Dokumentstruktur», kan festast på skjermen. Vindauge av denne typen kan flyttast eller festast til ein kant. Du kan også endra storleiken på dei." #: autohide.xhp msgctxt "" "autohide.xhp\n" "hd_id3154750\n" "65\n" "help.text" msgid "Docking and Undocking Windows" msgstr "Festa og losna vindauge" #: autohide.xhp msgctxt "" "autohide.xhp\n" "par_id3166460\n" "66\n" "help.text" msgid "To dock a window, do one of the following:" msgstr "Du kan festa eit vindauge på ein av desse måtane:" #: autohide.xhp msgctxt "" "autohide.xhp\n" "par_id3150503\n" "67\n" "help.text" msgid "Drag the window by its title bar to the side, or" msgstr "Dra vindauget til sida ved å bruka tittellinja, eller" #: autohide.xhp msgctxt "" "autohide.xhp\n" "par_id3150275\n" "68\n" "help.text" msgid "Double-click inside a vacant area of the window while holding down the CommandCtrl key. In the Styles and Formatting window, double-click a gray part of the window next to the icons while holding down the CommandCtrl key. Alternatively, press CommandCtrl+Shift+F10." msgstr "Dobbeltklikk inne i eit ledig område i vindauget medan du held nede CmdCtrl. Dobbeltklikk i dialogvindauget «Stilhandsamar» ein grå del av vindauget nær ikona medan du held nede CmdCtrl. Du kan også bruka tastesnarvegen CmdCtrl + Shift + F10." #: autohide.xhp msgctxt "" "autohide.xhp\n" "par_id3147335\n" "69\n" "help.text" msgid "These methods can also be used to undock a currently docked window." msgstr "Desse metodane kan også brukast for å losna eit festa vindauge." #: autohide.xhp msgctxt "" "autohide.xhp\n" "hd_id3149796\n" "70\n" "help.text" msgid "Showing and Hiding Docked Windows" msgstr "Vis og gøyma fastsette vindauge" #: autohide.xhp msgctxt "" "autohide.xhp\n" "par_id3149045\n" "help.text" msgid "Icon" msgstr "Ikon" #: autohide.xhp msgctxt "" "autohide.xhp\n" "par_id3152921\n" "64\n" "help.text" msgid "Click the button on the edge of the docked window to show or hide the docked window. The AutoHide function allows you to temporarily show a hidden window by clicking on its edge. When you click in the document, the docked window hides again." msgstr "Klikk på knappen i kanten av det festa vindauget for å visa eller gøyma det. Funksjonen for automatisk gøyming let deg visa eit gøymd vindauge temporært ved å trykka på knappen i kanten av vindauget. Det festa vindauget vert gøymd igjen når du klikkar i dokumentet." #: background.xhp msgctxt "" "background.xhp\n" "tit\n" "help.text" msgid "Defining Background Colors or Background Graphics" msgstr "Velja bakgrunnsfargar eller bakgrunnsbilete" #: background.xhp msgctxt "" "background.xhp\n" "bm_id3149346\n" "help.text" msgid "backgrounds; defining colors/picturescolors; backgroundspictures; backgroundspages; backgrounds in all applicationswatermarkstext, see also text documents, paragraphs and characters" msgstr "bakgrunnar; velja fargar/biletefargar; bakgrunnarbilete; bakgrunnarsider; bakgrunnar i alle programvassmerketekst, sjå også tekstdokument, avsnitt og teikn" #: background.xhp msgctxt "" "background.xhp\n" "hd_id3149346\n" "1\n" "help.text" msgid "Defining Graphics or Colors in the Background of Pages (Watermark) " msgstr "Velja bilete eller fargar som bakgrunn på sider (vassmerke) " #: background.xhp msgctxt "" "background.xhp\n" "par_id3153878\n" "25\n" "help.text" msgid "Choose Format - Page." msgstr "Vel Format → Side." #: background.xhp msgctxt "" "background.xhp\n" "par_id3149581\n" "26\n" "help.text" msgid "On the Background tab page, select a background color or a background graphic." msgstr "Vel ein farge eller eit bilete som skal brukast i bakgrunnen på fana Bakgrunn." #: background.xhp msgctxt "" "background.xhp\n" "par_id3154097\n" "27\n" "help.text" msgid "In spreadsheets this background appears only in the print behind the cells not formatted elsewhere." msgstr "I rekneark vert denne bakgrunnen berre vist på utskrifter bak celler som ikkje er formaterte på andre måtar." #: background.xhp msgctxt "" "background.xhp\n" "par_id3156180\n" "30\n" "help.text" msgid "Background tab page" msgstr "Fana Bakgrunn" #: background.xhp msgctxt "" "background.xhp\n" "par_id2711569\n" "help.text" msgid "Backgrounds in Text" msgstr "Bakgrunnar i tekst" #: background.xhp msgctxt "" "background.xhp\n" "par_id8591570\n" "help.text" msgid "Backgrounds in Spreadsheets" msgstr "Bakgrunnar i rekneark" #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "tit\n" "help.text" msgid "Defining Borders for Paragraphs" msgstr "Definera kantlinjer for avsnitt" #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "bm_id3147571\n" "help.text" msgid "borders, see also framesparagraphs; defining bordersborders; for paragraphsframes; around paragraphsinserting;paragraph bordersdefining;paragraph borders" msgstr "kantlinjer, sjå også rammeravsnitt; velja kantlinjerkantlinjer; for avsnittrammer; rundt avsnittsetja inn;kantlinjer for avsnittvelja;kantlinjer for avsnitt" #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "hd_id3147571\n" "15\n" "help.text" msgid "Defining Borders for Paragraphs " msgstr "Laga kantlinjer for avsnitt " #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "hd_id3159233\n" "1\n" "help.text" msgid "Setting a Predefined Border Style" msgstr "Angje ein innebygd kantlinjestil" #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "par_id3156113\n" "2\n" "help.text" msgid "Place the cursor in the paragraph for which you want to define a border." msgstr "Sett skrivemerket i avsnittet som du vil definera ei kantlinje for." #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "par_id3149398\n" "3\n" "help.text" msgid "Choose Format - Paragraph - Borders." msgstr "Vel Format → Avsnitt → Kantlinjer." #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "par_id3156326\n" "4\n" "help.text" msgid "Select one of the default border styles in the Default area." msgstr "Vel ein av standardstilane for kantlinjer i området Standard." #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "par_id3154285\n" "5\n" "help.text" msgid "Select a line style, width and color for the selected border style in the Line area. These settings apply to all border lines that are included in the selected border style." msgstr "Vel linjestil, breidde og farge for den valde kantlinjestilen i Linje. Desse innstillingane vert brukte på alle kantlinjene som er inkluderte i den valde kantlinjestilen." #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "par_id3153665\n" "6\n" "help.text" msgid "Select the distance between the border lines and the paragraph contents in the Spacing to contents area. You can only change distances to edges that have a border line defined." msgstr "Vel avstanden mellom kantlinjene og innhaldet i avsnittet i Avstand til innhaldet. Du kan berre endra avstanden til kantar som har ei kantlinje." #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "par_id3153543\n" "7\n" "help.text" msgid "Click OK to apply the changes." msgstr "Trykk på OK for å bruka endringane." #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "hd_id3149237\n" "8\n" "help.text" msgid "Setting a Customized Border Style" msgstr "Innstillingar for ein brukardefinert kantlinjestil" #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "par_id3155388\n" "9\n" "help.text" msgid "Choose Format - Paragraph - Borders." msgstr "Vel Format → Avsnitt → Kantlinjer." #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "par_id3148943\n" "10\n" "help.text" msgid "In the User-defined area select the edge(s) that you want to appear in a common layout. Click on an edge in the preview to toggle the selection of an edge." msgstr "Vel kanten eller kantane du vil bruka i eit vanleg oppsett i området Brukardefinert. Klikk på ein av kantane i førehandsvisingea for å slå av eller på valet av linja." #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "par_id3148948\n" "11\n" "help.text" msgid "Select a line style, width and color for the selected border style in the Line area. These settings apply to all border lines that are included in the selected border style." msgstr "Vel ein linjestil, breidde og ein farge for den valde kantlinjestilen i Linje. Desse innstillingane vert brukte på alle kantlinjene som høyrer til den valde kantstilen. " #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "par_id3152811\n" "12\n" "help.text" msgid "Repeat the last two steps for every border edge." msgstr "Gjenta dei to siste punkta for kvar kantlinje." #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "par_id3150793\n" "13\n" "help.text" msgid "Select the distance between the border lines and the paragraph contents in the Spacing to contents area. You can only change distances to edges that have a border line defined." msgstr "Vel avstanden mellom kantlinjene og innhaldet i avsnittet i Avstand til innhaldet. Du kan berre endra avstanden til kantar som har ei kantlinje." #: border_paragraph.xhp msgctxt "" "border_paragraph.xhp\n" "par_id3151178\n" "14\n" "help.text" msgid "Click OK to apply the changes." msgstr "Trykk på OK for å bruka endringane." #: border_table.xhp msgctxt "" "border_table.xhp\n" "tit\n" "help.text" msgid "Defining Borders for Tables and Table Cells" msgstr "Velja kantlinjer for tabellar og celler i tabellar" #: border_table.xhp msgctxt "" "border_table.xhp\n" "bm_id3155805\n" "help.text" msgid "tables in text; defining borderstables in spreadsheets;defining bordersborders; for tablesframes; around tablesdefining;table borders" msgstr "tabellar i tekst; velja kantlinjertabellar i rekneark; velja kantlinjerkantlinjer; for tabellarrammer; rundt tabellarvelja;kantlinjer i tabellar" #: border_table.xhp msgctxt "" "border_table.xhp\n" "hd_id3155805\n" "16\n" "help.text" msgid "Defining Borders for Tables and Table Cells" msgstr "Velja kantlinjer for tabellar og celler i tabellar" #: border_table.xhp msgctxt "" "border_table.xhp\n" "hd_id3147008\n" "1\n" "help.text" msgid "Setting a Predefined Border Style" msgstr "Velja ein innebygd kantlinjestil" #: border_table.xhp msgctxt "" "border_table.xhp\n" "par_id3146957\n" "2\n" "help.text" msgid "Select the table cells that you want to modify." msgstr "Merk dei cellene i tabellen du vil endra." #: border_table.xhp msgctxt "" "border_table.xhp\n" "par_id3156346\n" "3\n" "help.text" msgid "Click the Borders icon on the Table toolbar (Writer) or on the Line and Filling bar to open the Borders window." msgstr "Trykk på Kantlinjer i verktøylinja Tabell (i Writer) eller verktøylinja Linje og fyll for å opna vindauget Kantlinjer." #: border_table.xhp msgctxt "" "border_table.xhp\n" "par_id3143270\n" "5\n" "help.text" msgid "Click one of the predefined border styles." msgstr "Trykk på ein av dei førehandsdefinerte kantlinjestilane." #: border_table.xhp msgctxt "" "border_table.xhp\n" "par_id3156156\n" "6\n" "help.text" msgid "This adds the selected style to the current border style of the table cells. Select the blank border style at the top left of the Borders window to clear all border styles." msgstr "Dette legg til den valde stilen til den gjeldande kantlinjestilen for cellene. Vel den tomme kantlinjestilen øvst til venstre i vindauget Kantlinjer viss du vil fjerna alle kantlinjestilane." #: border_table.xhp msgctxt "" "border_table.xhp\n" "hd_id3153666\n" "7\n" "help.text" msgid "Setting a Customized Border Style" msgstr "Angje ein tilpassa kantlinjestil" #: border_table.xhp msgctxt "" "border_table.xhp\n" "par_id3152472\n" "8\n" "help.text" msgid "Select the table cells that you want to modify." msgstr "Merk dei cellene i tabellen du vil endra." #: border_table.xhp msgctxt "" "border_table.xhp\n" "par_id3147265\n" "9\n" "help.text" msgid "Choose Table - Table Properties - Borders (Writer) or Format - Cells - Borders (Calc)." msgstr "Vel Tabell → Tabelleigenskapar → Kantlinjer (Writer) eller Format → Celler → Kantlinjer (Calc)." #: border_table.xhp msgctxt "" "border_table.xhp\n" "par_id3159413\n" "10\n" "help.text" msgid "In the User-defined area select the edge(s) that you want to appear in a common layout. Click on an edge in the preview to toggle the selection of an edge." msgstr "Vel kanten (kantane) du vil bruka i eit vanleg oppsett i området Brukardefinert. Klikk på ein av kantane i førehandvisinga for å slå av eller på valet av kanten." #: border_table.xhp msgctxt "" "border_table.xhp\n" "par_id31594132\n" "help.text" msgid "If you select more than one row or column, you can change the middle lines between rows or columns. Select the middle markers in the User-defined area." msgstr "Har du merkt fleire rader eller kolonnar, kan du endra midtlinja mellom radene eller kolonnane. Vel midtlinjene i området Brukardefinert." #: border_table.xhp msgctxt "" "border_table.xhp\n" "par_id3153526\n" "11\n" "help.text" msgid "Select a line style and color for the selected border style in the Line area. These settings apply to all border lines that are included in the selected border style." msgstr "Vel ein linjestil og ein farge for den valde kantlinjestilen i Linje. Desse innstillingane vert brukte på alle kantlinjene som høyrer til den valde kantstilen." #: border_table.xhp msgctxt "" "border_table.xhp\n" "par_id3145606\n" "12\n" "help.text" msgid "Repeat the last two steps for every border edge." msgstr "Gjenta dei to siste punkta for kvar kantlinje." #: border_table.xhp msgctxt "" "border_table.xhp\n" "par_id3156422\n" "13\n" "help.text" msgid "Select the distance between the border lines and the page contents in the Spacing to contents area." msgstr "Vel avstanden mellom kantlinjene og innhaldet på sida i Avstand til innhaldet." #: border_table.xhp msgctxt "" "border_table.xhp\n" "par_id3149807\n" "14\n" "help.text" msgid "Click OK to apply the changes." msgstr "Trykk på OK for å bruka endringane. " #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "tit\n" "help.text" msgid "Inserting Line Breaks in Cells" msgstr "Setja inn linjeskift i celler" #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "bm_id6305734\n" "help.text" msgid "line breaks; in cells cells; line breaks text flow; in cells text breaks in cells wrapping text; in cells words; wrapping in cells automatic line breaks new lines in cells inserting;line breaks in cells tables;inserting line breaks" msgstr "linjeskift; i cellerceller; linjeskifttekstflyt; i cellertekstskift i cellerbryta tekst i cellerord; bryta i cellerautomatisk linjeskiftnye linjer i cellersetja inn;linjeskift i cellertabellar;setja inn linjeskift" #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "par_idN106D5\n" "help.text" msgid "Inserting Line Breaks in Cells" msgstr "Setja inn linjeskift i celler" #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "par_idN106D9\n" "help.text" msgid "Inserting line breaks in $[officename] Calc spreadsheet cells" msgstr "Setja inn linjeskift i celler i $[officename] Calc-rekneark" #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "par_idN106E0\n" "help.text" msgid "To insert a line break in a spreadsheet cell, press the CommandCtrl+Enter keys." msgstr "For å setje inn eit linjeskift i ei reknearkcelle, klikk i cella og deretter på «CmdCtrl + Enter»." #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "par_idN106E3\n" "help.text" msgid "This will work only with the text edit cursor inside the cell, not at the input line. So first double-click the cell, then single-click at the text position where you want the line break." msgstr "Dette verkar berre når skrivemerket for tekstredigering er inne i cella, ikkje i inndatalinja. Dobbeltklikk i cella og deretter enkeltklikk på staden i teksten der du vil setja inn linjeskift." #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "par_id0509200914160968\n" "help.text" msgid "You can search for a newline character in the Find & Replace dialog by searching for \\n as a regular expression. You can use the text function CHAR(10) to insert a newline character into a text formula." msgstr "Du kan søkja etter teiknet for ny linje (\\n) på vanleg måte i dialogvindauget «Søk og byt ut». Du kan bruka funksjonen CHAR(10) for å setja inn eit linjeskift i ein tekstformel." #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "par_idN106E6\n" "help.text" msgid "Formatting $[officename] Calc cells for automatic line wrapping" msgstr "Formatera $[officename] Calc-celler for automatisk linjeskift" #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "par_idN106ED\n" "help.text" msgid "Select the cells for which you want an automatic line break." msgstr "Merk cellene som skal ha automatisk linjeskift." #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "par_idN106F1\n" "help.text" msgid "Choose Format - Cells - Alignment." msgstr "Vel Format → Celler → Justering." #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "par_idN106F9\n" "help.text" msgid "Select Wrap text automatically." msgstr "Merk av for Bryt tekst automatisk." #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "par_idN10700\n" "help.text" msgid "Inserting line breaks in $[officename] Writer text document tables" msgstr "Setja inn linjeskift i tabellar i $[officename] Writer-tekstdokumenter" #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "par_idN10707\n" "help.text" msgid "To insert a line break in a text document table cell, press the Enter key." msgstr "I eit tekstdokument kan du setja inn eit linjeskift i ei celle ved å trykke Enter." #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "par_idN1070A\n" "help.text" msgid "An automatic line break will be performed while you type across the end of each cell." msgstr "Når du skriv inn ein tekst som går over slutten på kvar celle, vert det dett inn eit linjeskift automatisk." #: breaking_lines.xhp msgctxt "" "breaking_lines.xhp\n" "par_idN10718\n" "help.text" msgid "Alignment" msgstr "Justering" #: change_title.xhp msgctxt "" "change_title.xhp\n" "tit\n" "help.text" msgid "Changing the Title of a Document" msgstr "Gje ny tittel til eit dokument" #: change_title.xhp msgctxt "" "change_title.xhp\n" "bm_id3156324\n" "help.text" msgid "titles; changingchanging;document titlesdocuments; changing titles" msgstr "titlar; endraendra;dokumenttitlardokument; endra titlar" #: change_title.xhp msgctxt "" "change_title.xhp\n" "hd_id3156324\n" "1\n" "help.text" msgid "Changing the Title of a Document" msgstr "Gje ny tittel til eit dokument" #: change_title.xhp msgctxt "" "change_title.xhp\n" "par_id3152801\n" "3\n" "help.text" msgid "You can specify a title for your document. Some file manager utilities can display the titles next to the filenames of your documents." msgstr "Du kan gje ein tittel for dokumentet. Nokre filhandsamarar kan visa titlar ved sida av filnamnet til dokumenta." #: change_title.xhp msgctxt "" "change_title.xhp\n" "hd_id3156136\n" "4\n" "help.text" msgid "How to change the title of the current document" msgstr "Endra tittelen til det gjeldande dokumentet" #: change_title.xhp msgctxt "" "change_title.xhp\n" "par_id3153345\n" "5\n" "help.text" msgid "Choose File - Properties. This opens the Document Properties dialog." msgstr "Vel Fil → Eigenskapar for å opna dialogvindauget for dokumenteigenskapane." #: change_title.xhp msgctxt "" "change_title.xhp\n" "par_id3156410\n" "6\n" "help.text" msgid "Select the Description tab." msgstr "Vel fana Skildring." #: change_title.xhp msgctxt "" "change_title.xhp\n" "par_id3147242\n" "7\n" "help.text" msgid "Type the new title in the Title box and click OK." msgstr "Skriv inn den nye tittelen i feltet Tittel og trykk OK." #: change_title.xhp msgctxt "" "change_title.xhp\n" "par_id3163802\n" "8\n" "help.text" msgid "Document Properties" msgstr "Dokumenteigenskapar" #: chart_axis.xhp msgctxt "" "chart_axis.xhp\n" "tit\n" "help.text" msgid "Editing Chart Axes" msgstr "Redigera diagramaksar" #: chart_axis.xhp msgctxt "" "chart_axis.xhp\n" "bm_id3155555\n" "help.text" msgid "charts; editing axesaxes in chartsediting; chart axesformatting; axes in charts" msgstr "diagram; redigera aksaraksar i diagramredigera; diagramaksarformatera; aksar i diagram" #: chart_axis.xhp msgctxt "" "chart_axis.xhp\n" "hd_id3155555\n" "1\n" "help.text" msgid "Editing Chart Axes" msgstr "Redigera diagramaksar" #: chart_axis.xhp msgctxt "" "chart_axis.xhp\n" "par_id3156426\n" "2\n" "help.text" msgid "To edit the axes of a chart that you have inserted:" msgstr "Slik redigerer du aksane i eit diagram du har sett inn:" #: chart_axis.xhp msgctxt "" "chart_axis.xhp\n" "par_id3155535\n" "3\n" "help.text" msgid "Double-click on the chart." msgstr "Dobbeltklikk på diagrammet." #: chart_axis.xhp msgctxt "" "chart_axis.xhp\n" "par_id3147242\n" "4\n" "help.text" msgid "A gray border appears around the chart and the menu bar now contains commands for editing the objects in the chart." msgstr "Det kjem opp ein grå kant rundt diagrammet og menylinja vil nå innehalda val du kan bruka for å redigera objekta i diagrammet." #: chart_axis.xhp msgctxt "" "chart_axis.xhp\n" "par_id3154749\n" "5\n" "help.text" msgid "Choose Format - Axis, then select the axis (or axes) that you would like to edit. A dialog appears." msgstr "Vel Format → Akse og vel aksen eller aksane du vil redigera. Det vert opna eit dialogvindauge." #: chart_axis.xhp msgctxt "" "chart_axis.xhp\n" "par_id3154285\n" "6\n" "help.text" msgid "Select from the available sections and make the required changes (for example, select the Scale tab if you want to modify the scale of the axis)." msgstr "Bruk fanene i dialogvindauget til å gjera dei ønskte endringane. (Du kan for eksempel bruka fana Skalering til å endra skaleringa for aksen)." #: chart_axis.xhp msgctxt "" "chart_axis.xhp\n" "par_id3156327\n" "7\n" "help.text" msgid "Click OK. In your document, click outside the chart to exit chart editing mode." msgstr "Trykk OK. Trykk i dokumentet utføre diagrammet for å avslutta diagramredigeringstilstanden." #: chart_axis.xhp msgctxt "" "chart_axis.xhp\n" "par_id3147335\n" "8\n" "help.text" msgid "Format - Object properties" msgstr "Format → Objekt" #: chart_barformat.xhp msgctxt "" "chart_barformat.xhp\n" "tit\n" "help.text" msgid "Adding Texture to Chart Bars" msgstr "Leggja til overflate på søyler i diagram" #: chart_barformat.xhp msgctxt "" "chart_barformat.xhp\n" "bm_id3149798\n" "help.text" msgid "charts; bars with texturestextures;on chart barsinserting;textures on chart bars" msgstr "diagram; søyler og linjer med overflateroverflater; på søylerdiagram leggja til; overflate på søylediagram" #: chart_barformat.xhp msgctxt "" "chart_barformat.xhp\n" "hd_id3149798\n" "1\n" "help.text" msgid "Adding Texture to Chart Bars" msgstr "Leggja til tekstur på diagramsøyler" #: chart_barformat.xhp msgctxt "" "chart_barformat.xhp\n" "par_id3156136\n" "3\n" "help.text" msgid "You can add texture to the bars in a graph or chart (instead of the default colors) via bitmap graphics:" msgstr "Du kan leggja til overflate på søylene i ein graf eller eit diagram (i staden for standardfargar) med punktbilete:" #: chart_barformat.xhp msgctxt "" "chart_barformat.xhp\n" "par_id3153748\n" "4\n" "help.text" msgid "Enter edit mode by double-clicking on the chart." msgstr "Dobbeltklikk på diagrammet for å gå til redigeringstilstand." #: chart_barformat.xhp msgctxt "" "chart_barformat.xhp\n" "par_id3149182\n" "5\n" "help.text" msgid "Click on any bar of the bar series you want to edit. All bars of this series are now selected." msgstr "Klikk på ei av søylene i den serien som skal redigerast. Alle søylene i denne serien vert merkte. " #: chart_barformat.xhp msgctxt "" "chart_barformat.xhp\n" "par_id720847\n" "help.text" msgid "If you want to edit only one bar, click again on that bar." msgstr "Viss du vil redigera berre éin av søylene, dobbeltklikk på søylen igjen." #: chart_barformat.xhp msgctxt "" "chart_barformat.xhp\n" "par_id3147275\n" "6\n" "help.text" msgid "In the context menu choose Object Properties. Then choose the Area tab." msgstr "Vel Objekteigenskapar i sprettoppmenyen og gå til fana Område." #: chart_barformat.xhp msgctxt "" "chart_barformat.xhp\n" "par_id3146797\n" "7\n" "help.text" msgid "Click on Bitmap. In the list box select a bitmap as a texture for the currently selected bars. Click OK to accept the setting." msgstr "Vel Punktbilete under Fyll. Merk biletet du vil bruka som overflate på dei valde søylene. Klikk OK for å bruka innstillinga." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "tit\n" "help.text" msgid "Inserting Charts" msgstr "Setja inn diagram" #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "bm_id3153910\n" "help.text" msgid "charts; insertingplotting data as chartsinserting; chartsspreadsheets; inserting chartscharts; editing dataediting; chart data" msgstr "diagram; setja innplotte data som diagramsetja inn; diagramrekneark; setja inn diagramdiagram; redigera dataredigera; diagramdata" #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "hd_id3153910\n" "34\n" "help.text" msgid "Inserting Charts" msgstr "Setja inn diagram" #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id3139133\n" "help.text" msgid "Different methods exist to start a chart:" msgstr "Du kan setja inn diagram på fleire måtar:" #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id6772972\n" "help.text" msgid "Insert a chart based on data from cells in Calc or Writer." msgstr "Setja inn eit diagram som er basert på data frå celler i Calc eller Writer." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id6049684\n" "help.text" msgid "These charts update automatically when the source data changes." msgstr "Desse diagramma vert oppdaterte automatisk når kjeldedataane vert endra." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id2356944\n" "help.text" msgid "Insert a chart with a default data set, and then use the Data Table dialog to enter your own data for that chart." msgstr "Set inn eit diagram med eit standard datasett og bruk deretter dialogvindauget «Datatabell» for å skriva inn dine eigne data for dette diagrammet." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id866115\n" "help.text" msgid "These charts can be created in Writer, Impress and Draw." msgstr "Du kan lage desse diagramma i både Writer, Impress og Draw." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id3146763\n" "help.text" msgid "Copy a chart from Calc or Writer into another document." msgstr "Kopier eit diagram frå Calc eller Writer til eit anna dokument." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id701315\n" "help.text" msgid "These charts are snapshots of the data at the time of copying. They do not change when the source data changes." msgstr "Desse diagramma viser dataane slik dei var då dei vart kopierte. Dei vert ikkje endra når kjeldedataane vert endra." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id4439832\n" "help.text" msgid "In Calc, a chart is an object on a sheet that can be copied and pasted on another sheet of the same document, the data series will stay linked to the range on the other sheet. If it is pasted on another Calc document, it has its own chart data table and is no more linked to the original range." msgstr "I Calc er eit diagram eit objekt på eit ark og kan kopierast og setjast inn på eit anna ark i det same dokumentet. Dataserien vert framleis lenkja til området på det andre arket. Viss det vert kopiert til eit anna Calc-dokument, vil det få sin eigen datatabell, og er ikkje lenkja til det opphavlege området." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "hd_id719931\n" "help.text" msgid "Chart in a Calc spreadsheet" msgstr "Diagram i eit rekneark i Calc" #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id3150275\n" "4\n" "help.text" msgid "Click inside the cell range that you want to present in your chart." msgstr "Klikk inne i eit celleområde som du vil visa i diagrammet." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id7211218\n" "help.text" msgid "Click the Insert Chart icon on the Standard toolbar." msgstr "Trykk på symbolet Diagram i standardverktøylinja." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id7549363\n" "help.text" msgid "You see a chart preview and the Chart Wizard." msgstr "Du vil sjå ei førehandsvising av diagrammet og diagramvegvisaren." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id9091769\n" "help.text" msgid "Follow the instructions in the Chart Wizard to create the chart." msgstr "Følj instruksjonane i diagramvegvisaren for å laga diagrammet." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "hd_id3761406\n" "help.text" msgid "Chart in a Writer text document" msgstr "Diagram i eit tekstdokument i Writer" #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id3155066\n" "32\n" "help.text" msgid "In a Writer document, you can insert a chart based on the values in a Writer table." msgstr "I eit Writer-dokument kan du setja inn eit diagram som er basert på verdiane i ein tabell i Writer." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id428479\n" "help.text" msgid "Click inside the Writer table." msgstr "Klikk inne i tabellen i Writer." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id7236243\n" "help.text" msgid "Choose Insert - Object - Chart." msgstr "Vel Set inn → Objekt → Diagram." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id6171452\n" "help.text" msgid "You see a chart preview and the Chart Wizard." msgstr "Du vil få opp ei førehandsvising av diagrammet, og diagramvegvisaren." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id3145419\n" "7\n" "help.text" msgid "Follow the instructions in the Chart Wizard to create the chart." msgstr "Følj instruksjonane i diagramvegvisaren for å laga diagrammet." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "hd_id6436658\n" "help.text" msgid "Chart based on values of its own" msgstr "Diagram basert på eigne verdiar" #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id6944792\n" "help.text" msgid "In Writer, if you have not selected any cells, choose Insert - Object - Chart to insert a chart with default data. In Draw or Impress, choose Insert - Chart to insert a chart based on default data." msgstr "Viss du ikkje har merkt celler i Writer, vel Set inn → Objekt → Diagram for å setja inn eit diagram med standarddata. I Draw eller Impress vel du Set inn → Diagram for å setja inn eit diagram basert på standarddata." #: chart_insert.xhp msgctxt "" "chart_insert.xhp\n" "par_id3152960\n" "29\n" "help.text" msgid "You can change the default data values by double-clicking on the chart and then choosing View - Chart Data Table." msgstr "Du kan endra standarddataverdiane ved å dobbeltklikka på diagrammet og velja Vis → Diagramdatatabell." #: chart_legend.xhp msgctxt "" "chart_legend.xhp\n" "tit\n" "help.text" msgid "Editing Chart Legends" msgstr "Redigera diagramforklaringar" #: chart_legend.xhp msgctxt "" "chart_legend.xhp\n" "bm_id3147291\n" "help.text" msgid "charts; editing legendslegends; chartsediting; chart legendsformatting; chart legends" msgstr "diagram; redigera aksaraksar i diagramredigera; diagramaksarformatera; aksar i diagram" #: chart_legend.xhp msgctxt "" "chart_legend.xhp\n" "hd_id3147291\n" "1\n" "help.text" msgid "Editing Chart Legends" msgstr "Redigera diagramforklaringar" #: chart_legend.xhp msgctxt "" "chart_legend.xhp\n" "par_id3147008\n" "2\n" "help.text" msgid "To edit a chart legend:" msgstr "Slik redigerar du ei diagramforklaring:" #: chart_legend.xhp msgctxt "" "chart_legend.xhp\n" "par_id3146957\n" "3\n" "help.text" msgid "Double-click on the chart." msgstr "Dobbeltklikk på diagrammet." #: chart_legend.xhp msgctxt "" "chart_legend.xhp\n" "par_id3154824\n" "4\n" "help.text" msgid "A gray border appears around the chart and the menu bar now contains commands for editing the objects in the chart." msgstr "Det kjem fram ein grå kant rundt diagrammet og menylinja vil nå innehalda kommandoar du kan bruka for å redigera objekta i diagrammet." #: chart_legend.xhp msgctxt "" "chart_legend.xhp\n" "par_id3153031\n" "5\n" "help.text" msgid "Choose Format - Legend or double-click on the legend. This opens the Legend dialog." msgstr "Vel Format → Forklaring eller dobbeltklikk på forklaringa for å opna dialogvindauget Forklaring." #: chart_legend.xhp msgctxt "" "chart_legend.xhp\n" "par_id3147210\n" "6\n" "help.text" msgid "Choose from the available tabs to make modifications, then click OK." msgstr "Bruk fanene i dialogvindauget for å gjera endringane og trykk deretter OK." #: chart_legend.xhp msgctxt "" "chart_legend.xhp\n" "par_id3145674\n" "9\n" "help.text" msgid "To select the legend, first double-click on the chart (see step 1), then click on the legend. You can now move the legend within the chart using the mouse." msgstr "Skal du merka ei forklaring, dobbeltklikkar du først på diagrammet (sjå steg 1), deretter klikkar du på forklaringa. Nå kan du bruke musa til å flytte forklaringa til ein annan stad i diagrammet." #: chart_legend.xhp msgctxt "" "chart_legend.xhp\n" "par_id3154347\n" "11\n" "help.text" msgid "Format - Object Properties" msgstr "Format → Objekteigenskapar" #: chart_title.xhp msgctxt "" "chart_title.xhp\n" "tit\n" "help.text" msgid "Editing Chart Titles" msgstr "Redigera diagramtitlar" #: chart_title.xhp msgctxt "" "chart_title.xhp\n" "bm_id3156136\n" "help.text" msgid "charts; editing titlesediting; chart titlestitles; editing in charts" msgstr "diagram; redigera titlarredigera; diagramtitlartitlar; redigera i diagram" #: chart_title.xhp msgctxt "" "chart_title.xhp\n" "hd_id3156136\n" "1\n" "help.text" msgid "Editing Chart Titles" msgstr "Redigera diagramtitlar" #: chart_title.xhp msgctxt "" "chart_title.xhp\n" "par_id3153527\n" "2\n" "help.text" msgid "To edit a chart title that you have inserted into a $[officename] document:" msgstr "Slik redigerer du ein diagramtittel du har sett inn i eit $[officename]-dokument:" #: chart_title.xhp msgctxt "" "chart_title.xhp\n" "par_id3153681\n" "3\n" "help.text" msgid "Double-click on the chart." msgstr "Dobbeltklikk på diagrammet." #: chart_title.xhp msgctxt "" "chart_title.xhp\n" "par_id3145345\n" "4\n" "help.text" msgid "A gray border appears around the chart and the menu bar now contains commands for editing the objects in the chart." msgstr "Det kjem fram ein grå kant rundt diagrammet og menylinja vil nå innehalde kommandoar du kan bruka til redigeringa." #: chart_title.xhp msgctxt "" "chart_title.xhp\n" "par_id3149811\n" "5\n" "help.text" msgid "Double-click on an existing title text. A gray border appears around the text and you can now make changes. Press Enter to create a new line." msgstr "Dobbeltklikk på ein eksisterande titteltekst. Det kjem då fram ein grå kant rundt teksten for å visa at du nå kan redigera teksten. Trykk Enter for å gå til ny linje." #: chart_title.xhp msgctxt "" "chart_title.xhp\n" "par_id2706991\n" "help.text" msgid "If no title text exists, choose Insert - Title to enter the text in a dialog." msgstr "Finst det ingen titteltekst frå før, vel du Set inn → Tittel for å skriva inn tekst i dialogvindauget." #: chart_title.xhp msgctxt "" "chart_title.xhp\n" "par_id3145382\n" "6\n" "help.text" msgid "A single-click on the title allows you to move it with the mouse." msgstr "Du kan flytta tittelen ved å klikka på han og dra han med musa dit du ønskjer." #: chart_title.xhp msgctxt "" "chart_title.xhp\n" "par_id3155341\n" "7\n" "help.text" msgid "If you want to change the formatting of the main title, choose Format - Title - Main Title. This opens the Title dialog." msgstr "Viss du vil endra formateringa til hovudtittelen, vel du Format → Tittel → Hovudtittel. Dette vil opna dialogvindauget Overskrift." #: chart_title.xhp msgctxt "" "chart_title.xhp\n" "par_id3147336\n" "8\n" "help.text" msgid "Select one of the available tabs in the dialog to make modifications." msgstr "Vel ei av fanene i dialogvindauget for å gjera endringane." #: chart_title.xhp msgctxt "" "chart_title.xhp\n" "par_id3155135\n" "9\n" "help.text" msgid "Click OK. In your document, click outside the chart to exit chart editing mode." msgstr "Trykk OK. Trykk i dokumentet utføre diagrammet for å avslutta diagramredigeringstilstanden." #: chart_title.xhp msgctxt "" "chart_title.xhp\n" "par_id3154046\n" "10\n" "help.text" msgid "Format - Object properties" msgstr "Format → Objekt" #: collab.xhp msgctxt "" "collab.xhp\n" "tit\n" "help.text" msgid "Collaboration" msgstr "Samarbeid" #: collab.xhp msgctxt "" "collab.xhp\n" "bm_id4459669\n" "help.text" msgid "sharing documentscollaborationfile locking with collaborationlocked documents" msgstr "snu; teikneobjektrotera; teikneobjekt teikneobjekt; snuteikneobjekt; roterapivotpunkt i teikneobjektskråstilla teikneobjekt" #: collab.xhp msgctxt "" "collab.xhp\n" "hd_id130008\n" "help.text" msgid "Collaboration" msgstr "Samarbeid" #: collab.xhp msgctxt "" "collab.xhp\n" "par_id5821710\n" "help.text" msgid "In %PRODUCTNAME Writer, Impress, and Draw, only one user at a time can open any document for writing. In Calc, many users can open the same spreadsheet for writing at the same time." msgstr "I %PRODUCTNAME Writer, Impress og Draw kan berre éin bruker om gongen opna eit dokument for skriving. I Calc kan mange brukarar ha det same reknearket opna samstundes for skriving." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id9590136\n" "help.text" msgid "Opens the Share Document dialog where you can enable or disable collaborative sharing of the document." msgstr "Opnar dialogvindauget Del dokument der du kan slå deling av dokumentet på eller av." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id2519913\n" "help.text" msgid "Enable to share the current document with other users. Disable to use the document unshared. This will invalidate the not yet saved edits that other users applied in the time since you last opened or saved this document." msgstr "Slå på for å dela det gjeldande reknearket med andre brukarar. Slå av for å bruka dokumentet utan å dela det med andre. Dette vil forkasta endringar som i er gjort av andre brukarar i mellomtida utan å verta lagra." #: collab.xhp msgctxt "" "collab.xhp\n" "hd_id6917020\n" "help.text" msgid "Collaboration in Calc" msgstr "Samarbeid i Calc" #: collab.xhp msgctxt "" "collab.xhp\n" "par_id4411145\n" "help.text" msgid "In %PRODUCTNAME Calc, document sharing allows simultaneous write access for many users. Every user who wants to collaborate should enter a name on the %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME - User Data tab page." msgstr "Vel om ei lysbiletframvising startar med det gjeldande lysbiletet, eller med det første lysbiletet i Funksjonar → Innstillingar → %PRODUCTNAME Impress → Generelt." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id6799218\n" "help.text" msgid "Some commands are not available (grayed out) when change tracking or document sharing is activated. For a new spreadsheet you cannot apply or insert the grayed out elements." msgstr "Nokre kommandoar er ikkje tilgjengelege (er gråa ut) når sporing av endringar eller deling av dokument er slått på. Du kan ikkje bruka eller setja inn element som er gråa ut i nye rekneark." #: collab.xhp msgctxt "" "collab.xhp\n" "hd_id3274941\n" "help.text" msgid "Creating a new spreadsheet" msgstr "Laga eit nytt rekneark" #: collab.xhp msgctxt "" "collab.xhp\n" "par_id9804681\n" "help.text" msgid "User A creates a new spreadsheet document. The following conditions can apply:" msgstr "Brukar A lagar eit nytt rekneark. Desse vilkåra kan gjelda:" #: collab.xhp msgctxt "" "collab.xhp\n" "par_id2109744\n" "help.text" msgid "The user does not want to share the spreadsheet for collaboration." msgstr "Brukaren ønskjer ikkje å dela reknearket for samarbeid." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id5374614\n" "help.text" msgid "User A opens, edits, and saves the document as described above for Writer, Impress, and Draw document." msgstr "Brukar A opnar, redigerer og lagrar dokumentet slik det er omtalt for Writer-, Impress- og Draw-dokument ovanfor." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id768761\n" "help.text" msgid "The user wants to share the document for collaboration." msgstr "Brukaren ønskjer å dela dokumentet for samarbeid. " #: collab.xhp msgctxt "" "collab.xhp\n" "par_id6844691\n" "help.text" msgid "The user chooses Tools - Share Document to activate the collaboration features for this document. A dialog opens where the user can choose to enable or disable sharing. If the user enables sharing, the document will be saved in shared mode, which is also shown on the title bar." msgstr "Brukaren vel Verktøy → Del dokument for å slå på samarbeidsfunksjonene for dette dokumentet. Det vert opna eit dialogvindauge der brukaren kan velja å slå deling på eller av. Viss brukaren slår på deling, vert dokumentet lagra i delt tilstand, noko som også vert vist i tittellinja for dokumentet." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id5288857\n" "help.text" msgid "The Tools - Share Document command can be used to switch the mode for the current document from unshared mode to shared mode. If you want to use a shared document in unshared mode, you would save the shared document using another name or path. This creates a copy of the spreadsheet that is not shared." msgstr "Du kan bruka Verktøy → Del dokument til å skifta modus for det gjeldande dokumentet frå udelt tilstand til delt tilstand. Viss du vil bruka eit delt dokument i udelt tilstand, lagrar du det delte dokumentet med eit anna namn eller til ein annan sti for å få ein kopi av reknearket som ikkje er delt." #: collab.xhp msgctxt "" "collab.xhp\n" "hd_id8842127\n" "help.text" msgid "Opening a spreadsheet" msgstr "Opna eit rekneark" #: collab.xhp msgctxt "" "collab.xhp\n" "par_id7276528\n" "help.text" msgid "User A opens a spreadsheet document. The following conditions can apply:" msgstr "Brukar A opnar eit rekneark. Desse vilkåra er moglege:" #: collab.xhp msgctxt "" "collab.xhp\n" "par_id8363902\n" "help.text" msgid "The spreadsheet document is not in shared mode." msgstr "Reknearkdokumentet er ikkje i delt tilstand." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id5974303\n" "help.text" msgid "The user can open, edit, and save the document as described above for Writer, Impress, and Draw documents." msgstr "Brukaren kan opna, redigere og lagra dokumentet slik det er forklart for Writer-, Impress- og Draw-dokumenter ovanfor." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id5323343\n" "help.text" msgid "The spreadsheet document is in shared mode." msgstr "Reknearkdokumentet er i delt tilstand. " #: collab.xhp msgctxt "" "collab.xhp\n" "par_id5824457\n" "help.text" msgid "The user sees a message that the document is in shared mode and that some features are not available in this mode. The user can disable this message for the future. After clicking OK, the document is opened in shared mode." msgstr "Brukaren får ei melding om at dokumentet er i delt tilstand og at nokre funksjonar ikkje er tilgjengelege i denne tilstanden. Brukaren kan velja å slå av visinga av denne meldinga i framtida. Når brukaren trykker OK, vert dokumentet opna i delt tilstand." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id5800653\n" "help.text" msgid "If the same contents are changed by different users, the Resolve Conflicts dialog opens. For each conflict, decide which changes to keep." msgstr "Viss fleire brukarar har endra det same innhaldet, vert dialogvindauget Løys konfliktar opna. Du må sjå på kvar konflikt og bestemma kva endringar som skal brukast." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id6263924\n" "help.text" msgid "Keeps your change, voids the other change." msgstr "Beheld endringane dine og ignorer andre endringar." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id3609118\n" "help.text" msgid "Keeps the change of the other user, voids your change." msgstr "Beheld endringar andre brukarar har gjort og ser bort frå endringane dine." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id7184057\n" "help.text" msgid "Keeps all your changes, voids all other changes." msgstr "Beheld alle endringane dine og ser bort frå alle andre endringar." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id786767\n" "help.text" msgid "Keeps the changes of all other users, voids your changes." msgstr "Beheld endringane andre brukarar har gjort og ser bort frå dine eigne endringar." #: collab.xhp msgctxt "" "collab.xhp\n" "hd_id2934965\n" "help.text" msgid "Saving a shared spreadsheet document" msgstr "Lagra eit delt reknearkdokument" #: collab.xhp msgctxt "" "collab.xhp\n" "par_id1174657\n" "help.text" msgid "User A saves a shared document. The following conditions can apply:" msgstr "Brukar A lagrar eit delt dokument. Desse vilkåra kan gjelda:" #: collab.xhp msgctxt "" "collab.xhp\n" "par_id2577593\n" "help.text" msgid "The document was not modified and saved by another user since user A opened the document." msgstr "Dokumentet er ikkje endra og lagra av nokon annan brukar sidan brukar A opna dokumentet." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id5883968\n" "help.text" msgid "The document is saved." msgstr "Dokumentet er lagra." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id9049653\n" "help.text" msgid "The document was modified and saved by another user since user A opened the document." msgstr "Dokumentet er endra og lagra av ein annan brukar sidan brukar A opna dokumentet. " #: collab.xhp msgctxt "" "collab.xhp\n" "par_id1976683\n" "help.text" msgid "If the changes do not conflict, the document is saved." msgstr "Viss det ikkje er konflikt mellom endringane, vert dokumentet lagra." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id43946\n" "help.text" msgid "If the changes conflict, the Resolve Conflicts dialog will be shown. User A must decide for the conflicts which version to keep, \"Keep Mine\" or \"Keep Other\". When all conflicts are resolved, the document is saved. While user A resolves the conflicts, no other user is able to save the shared document." msgstr "Viss det er konflikt mellom endringane, vert dialogvindauget Løys konfliktar opna. For kvar konflikt må A avgjera kva versjon som skal brukast ved å vela «Bruk mine» eller «Bruk andre». Når alle konfliktar er løyste, vert dokumentet lagra. Så lenge brukar A arbeider med å løyse konfliktane, kan ingen andre brukarar lagra det delte dokumentet." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id6449171\n" "help.text" msgid "Another user tries to save the shared document and resolves conflicts in this moment." msgstr "Ein annan brukar prøver å lagra det delte dokumentet og er i ferd med å løysa konfliktar i det." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id7101046\n" "help.text" msgid "User A sees a message that a merge-in is in progress. User A can choose to cancel the save command for now, or retry saving some time later." msgstr "Brukar A ser ei melding om at ein annan brukar er i ferd med å gjera endringar i dokumentet. Brukar A kan velja å avbryta lagringa og prøva å lagra seinare." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id7186498\n" "help.text" msgid "When a user successfully saves a shared spreadsheet, the document will be reloaded after the save command, so that the spreadsheet shows the latest version of all changes that got saved by all users. A message shows that \"foreign changes have been added\" when another user did change some contents." msgstr "Når ein brukar lagrar eit delt rekneark, vert dokumentet lasta inn på nytt etter lagringa slik at reknearket alltid er oppdatert på alle endringane gjort av alle brukarane. Når ein annan brukar endrar innhaldet, kjem det fram ei melding om at «andre endringar er lagt til»." #: collab.xhp msgctxt "" "collab.xhp\n" "hd_id2871791\n" "help.text" msgid "Collaboration in Writer, Impress, and Draw" msgstr "Samarbeid i Writer, Impress og Draw" #: collab.xhp msgctxt "" "collab.xhp\n" "par_id2675862\n" "help.text" msgid "For all modules Writer, Impress, Draw, and for Calc when document sharing is not enabled, a file locking is possible. This file locking is available even when accessing the same document from different operating systems:" msgstr "For Writer, Impress, Draw og Calc gjeld det at når deling av dokument ikkje er slått på, kan ei fil låsast. Denne fillåsinga er tilgjengeleg også om du brukar andre operativsystem for å få tilgang til det same dokumentet:" #: collab.xhp msgctxt "" "collab.xhp\n" "par_id7333597\n" "help.text" msgid "User A opens a document. The following conditions can apply:" msgstr "Brukar A opnar eit dokument. Desse vilkåra kan gjelda:" #: collab.xhp msgctxt "" "collab.xhp\n" "par_id9976195\n" "help.text" msgid "The document is not locked by any other user." msgstr "Dokumentet er ikkje låst av ein annan brukar." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id2507400\n" "help.text" msgid "This document will be opened for read and write access by user A. The document will be locked for other users until user A closes the document." msgstr "Dette dokumentet vert opna for å gje brukar A både lese- og skrivetilgang. Dokumentet vert låst for andre brukarar til brukar A lukkar dokumentet." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id216681\n" "help.text" msgid "The document is marked as \"read-only\" by the file system." msgstr "Dokumentet er merkt som «skriveverna» av filsystemet." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id7709585\n" "help.text" msgid "This document will be opened in read-only mode. Editing is not allowed. User A can save the document using another document name or another path. User A can edit this copy." msgstr "Dette dokumentet vert opna som skriveverna. Redigering er ikkje tillate. Brukar A kan lagra dokumentet ved å gje dokumentet eit anna namn eller lagra det til ein annan sti. Brukar A kan redigera denne kopien." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id4309518\n" "help.text" msgid "The document is locked by another user." msgstr "Dokumentet er låst av ein annan brukar." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id206610\n" "help.text" msgid "User A sees a dialog that tells the user the document is locked. The dialog offers to open the document in read-only mode, or to open a copy for editing, or to cancel the Open command." msgstr "Bruker A ser eit dialogvindauge som fortel at dokumentet er låst. Dialogvindauget har val for å opna dokumentet i skriveverna tilstand eller å opna ein kopi for redigering eller å avbryta opna-kommandoen." #: collab.xhp msgctxt "" "collab.xhp\n" "hd_id29349651\n" "help.text" msgid "User access permissions and sharing documents" msgstr "Brukartilgang og deling av dokument" #: collab.xhp msgctxt "" "collab.xhp\n" "par_id11746571\n" "help.text" msgid "Some conditions must be met on operating systems with a user permission management." msgstr "Nokre vilkår må oppfyllast på operativsystemet ved styring av brukarrettar." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id25775931\n" "help.text" msgid "The shared file needs to reside in a location which is accessible by all collaborators." msgstr "Dei delte filene må liggja på ein stad som er tilgjengeleg for alle samarbeidspartnarane." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id90496531\n" "help.text" msgid "The file permissions for both the document and the corresponding lock file need to be set so that all collaborators can create, delete, and change the files." msgstr "Filrettane for både dokumentet og den tilsvarande låsefila må vera sett slik at alle samarbeidspartnarane kan laga, sletta og endra filene." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id71864981\n" "help.text" msgid "Write access also enables other users to (accidentally or deliberately) delete or change a file." msgstr "Skrivetilgangen fører til at andre brukarar, ved eit uhell eller med vilje, kan sletta eller endra ei fil." #: collab.xhp msgctxt "" "collab.xhp\n" "par_id4263740\n" "help.text" msgid "Save As" msgstr "Ark" #: configure_overview.xhp msgctxt "" "configure_overview.xhp\n" "tit\n" "help.text" msgid "Configuring $[officename]" msgstr "Setja opp $[officename]" #: configure_overview.xhp msgctxt "" "configure_overview.xhp\n" "bm_id3152801\n" "help.text" msgid "configuring; $[officename]customizing; $[officename]" msgstr "oppsett; $[officename]tilpassa; $[officename]" #: configure_overview.xhp msgctxt "" "configure_overview.xhp\n" "hd_id3152801\n" "44\n" "help.text" msgid "Configuring $[officename]" msgstr "Setja opp $[officename]" #: configure_overview.xhp msgctxt "" "configure_overview.xhp\n" "par_id3153345\n" "43\n" "help.text" msgid "You can customize your $[officename] to suit your needs." msgstr "Du kan tilpassa $[officename] etter eigne behov." #: configure_overview.xhp msgctxt "" "configure_overview.xhp\n" "par_id3145071\n" "46\n" "help.text" msgid "You are free to change the items on the menu bar. You can delete items, add new ones, copy items from one menu to another, rename them, and so on." msgstr "Du kan fritt endra elementa på menylinja. Du kan sletta element, leggja til nye, kopiera element frå ein meny til ein annan, gje element nytt namn osv." #: configure_overview.xhp msgctxt "" "configure_overview.xhp\n" "par_id3149811\n" "47\n" "help.text" msgid "The toolbars may be freely configured." msgstr "Du kan setja opp verktøylinjene akkurat slik du vil ha dei." #: configure_overview.xhp msgctxt "" "configure_overview.xhp\n" "par_id3150443\n" "48\n" "help.text" msgid "You can change the shortcut keys." msgstr "Du kan endra snartastane." #: configure_overview.xhp msgctxt "" "configure_overview.xhp\n" "par_id3155421\n" "49\n" "help.text" msgid "To change these, choose Tools - Customize to open the Customize dialog." msgstr "Du kan gjera desse endringane ved å velja Verktøy → Tilpass for å opna dialogvindauget Tilpass." #: configure_overview.xhp msgctxt "" "configure_overview.xhp\n" "par_id3155388\n" "45\n" "help.text" msgid "Tools - Customize" msgstr "Verktøy → Tilpass" #: contextmenu.xhp msgctxt "" "contextmenu.xhp\n" "tit\n" "help.text" msgid "Using Context Menus" msgstr "Bruka sprettoppmenyar" #: contextmenu.xhp msgctxt "" "contextmenu.xhp\n" "bm_id3153394\n" "help.text" msgid "context menusmenus;activating context menusopening; context menusactivating;context menus" msgstr "sprettoppmenyermenyar;slå på sprettoppmenyaropna; sprettoppmenyarslå på;sprettoppmenyar" #: contextmenu.xhp msgctxt "" "contextmenu.xhp\n" "hd_id3153394\n" "5\n" "help.text" msgid "Using Context Menus" msgstr "Bruka sprettoppmenyar" #: copy_drawfunctions.xhp msgctxt "" "copy_drawfunctions.xhp\n" "tit\n" "help.text" msgid "Copying Drawing Objects Into Other Documents" msgstr "Kopiera teikneobjekt til andre dokument" #: copy_drawfunctions.xhp msgctxt "" "copy_drawfunctions.xhp\n" "bm_id3153394\n" "help.text" msgid "draw objects; copying between documentscopying; draw objects between documentspasting;draw objects from other documents" msgstr "teikneobjekt; kopiera mellom dokumentkopiera; teikneobjekt mellom dokumentlime inn; teikneobjekt frå andre dokument" #: copy_drawfunctions.xhp msgctxt "" "copy_drawfunctions.xhp\n" "hd_id3153394\n" "27\n" "help.text" msgid "Copying Drawing Objects Into Other Documents" msgstr "Kopiera teikneobjekt til andre dokument" #: copy_drawfunctions.xhp msgctxt "" "copy_drawfunctions.xhp\n" "par_id3153345\n" "28\n" "help.text" msgid "In $[officename] it is possible to copy drawing objects between text, spreadsheets and presentation documents." msgstr "I $[officename] kan du kopiera teikneobjekt mellom tekst-, rekneark- og presentasjonsdokument." #: copy_drawfunctions.xhp msgctxt "" "copy_drawfunctions.xhp\n" "par_id3145345\n" "29\n" "help.text" msgid "Select the drawing object or objects." msgstr "Merk teikneobjektet eller -objekta." #: copy_drawfunctions.xhp msgctxt "" "copy_drawfunctions.xhp\n" "par_id3156426\n" "31\n" "help.text" msgid "Copy the drawing object to the clipboard, for example, by using CommandCtrl+C." msgstr "Kopier teikninga til utklippstavla for eksempel ved å trykka «CmdCtrl + C»." #: copy_drawfunctions.xhp msgctxt "" "copy_drawfunctions.xhp\n" "par_id3152996\n" "32\n" "help.text" msgid "Switch to the other document and place the cursor where the drawing object is to be inserted." msgstr "Byt til det andre dokumentet og plasser markøren der du vil setja inn teikneobjektet." #: copy_drawfunctions.xhp msgctxt "" "copy_drawfunctions.xhp\n" "par_id3149234\n" "33\n" "help.text" msgid "Insert the drawing object, for example, by using CommandCtrl+V." msgstr "Set inn teikninga for eksempel ved å bruka Cmd Ctrl + V." #: copy_drawfunctions.xhp msgctxt "" "copy_drawfunctions.xhp\n" "hd_id3147573\n" "34\n" "help.text" msgid "Inserting into a text document" msgstr "Setja inn i eit tekstdokument" #: copy_drawfunctions.xhp msgctxt "" "copy_drawfunctions.xhp\n" "par_id3150276\n" "35\n" "help.text" msgid "An inserted drawing object is anchored to the current paragraph. You can change the anchor by selecting the object and clicking the Change Anchor icon on the OLE-Object toolbar or the Frame toolbar. This opens a popup menu where you can select the anchor type." msgstr "Eit teikneobjekt som vert set inn vert forankra til det gjeldande avsnittet. Du kan endra forankringa ved å merke objektet og trykke på knappen Endra forankring i verktøylinja OLE-objekt eller verktøylinja Ramme. Nå vert det opna ein sprettoppmeny der du kan velja forankringstype." #: copy_drawfunctions.xhp msgctxt "" "copy_drawfunctions.xhp\n" "hd_id3145609\n" "36\n" "help.text" msgid "Inserting into a spreadsheet" msgstr "Setja inn i eit rekneark" #: copy_drawfunctions.xhp msgctxt "" "copy_drawfunctions.xhp\n" "par_id3151210\n" "30\n" "help.text" msgid "An inserted drawing object is anchored to the current cell. You can change the anchor between cell and page by selecting the object and clicking the Change Anchor icon Icon." msgstr "Eit teikneobjekt som vert sett inn vert forankra til den gjeldande cella. Du kan endra forankringa mellom cella og sida ved å merke objektet og trykke på knappen Endra forankring Ikon." #: copytable2application.xhp msgctxt "" "copytable2application.xhp\n" "tit\n" "help.text" msgid "Inserting Data From Spreadsheets" msgstr "Setja inn data frå rekneark" #: copytable2application.xhp msgctxt "" "copytable2application.xhp\n" "bm_id3154186\n" "help.text" msgid "charts;copying with link to source cell rangeinserting; cell ranges from spreadsheetspasting;cell ranges from spreadsheetspresentations;inserting spreadsheet cellstext documents;inserting spreadsheet cellstables in spreadsheets;copying data to other applications" msgstr "diagram;kopiera med lenkje til kjeldecelleområdesetja inn; celleområde frå reknearklima inn;celleområde frå reknearkpresentasjonar;setja inn reknearkcellertekstdokument;setja inn reknearkcellertabellar i rekneark;kopiera data til andre program" #: copytable2application.xhp msgctxt "" "copytable2application.xhp\n" "hd_id3154186\n" "9\n" "help.text" msgid "Inserting Data From Spreadsheets" msgstr "Setja inn data frå rekneark" #: copytable2application.xhp msgctxt "" "copytable2application.xhp\n" "par_id3147088\n" "10\n" "help.text" msgid "Use the clipboard to copy the contents of a single cell. You can also copy a formula from a cell into the clipboard (for example, from the input line of the formula bar) so that the formula can be inserted into a text." msgstr "Bruk utklippstavla til å kopiera innhaldet i ei enkelt celle. Du kan også kopiera ein formel frå ei celle til utklippstavla (for eksempel frå inndatalinja i formellinja) slik at formelen kan setjast inn i tekst." #: copytable2application.xhp msgctxt "" "copytable2application.xhp\n" "par_id3145345\n" "11\n" "help.text" msgid "To copy a cell range into a text document, select the cell range in the sheet and then use either the clipboard or drag-and-drop to insert the cells into the text document. You will then find an OLE object in the text document, which you can edit further." msgstr "Viss du vil kopiera eit celleområde til eit tekstdokument, kan du merka celleområdet i reknearket og deretter bruka anten utklippstavla eller dra og slepp til å setja innhaldet i cellene inn i tekstdokumentet. Området vert sett inn i tekstdokumentet som eit OLE-objekt du kan redigera." #: copytable2application.xhp msgctxt "" "copytable2application.xhp\n" "par_id3146957\n" "12\n" "help.text" msgid "If you drag cells to the normal view of a presentation document, the cells will be inserted there as an OLE object. If you drag cells into the outline view, each cell will form a line of the outline view." msgstr "Viss du drar celler til normalvisinga i eit presentasjonsdokument, vert cellene sett inn der som eit OLE-objekt. Viss du drar cellene og slepp dei i disposisjonsvisinga, vil kvar celle laga ei linje i visinga." #: copytable2application.xhp msgctxt "" "copytable2application.xhp\n" "par_id3148538\n" "13\n" "help.text" msgid "When you copy a cell range from $[officename] Calc to the clipboard, the drawing objects, OLE objects and charts within this range are also copied." msgstr "Når du kopierer eit celleområde frå $[officename] Calc til utklippstavla, vert også teikneobjekt, OLE-objekt og diagram i det same området kopierte." #: copytable2application.xhp msgctxt "" "copytable2application.xhp\n" "par_id3153031\n" "14\n" "help.text" msgid "If you insert a cell range with an enclosed chart, the chart will keep its link to the source cell range only if you copied the chart and the source cell range together." msgstr "Viss du set inn eit celleområde med eit innebygd diagram, vil diagrammet behalda lenkja til kjeldecellene berre viss diagrammet og kjeldecelleområdet vert kopierte samstundes." #: copytext2application.xhp msgctxt "" "copytext2application.xhp\n" "tit\n" "help.text" msgid "Inserting Data From Text Documents" msgstr "Setja inn data frå tekstdokument" #: copytext2application.xhp msgctxt "" "copytext2application.xhp\n" "bm_id3152924\n" "help.text" msgid "sending; AutoAbstract function in presentationsAutoAbstract function for sending text to presentationsoutlines; sending to presentationstext; copying by drag and dropdrag and drop; copying and pasting textinserting;data from text documentscopying;data from text documentspasting;data from text documents" msgstr "sending; funksjonen autosamandrag i presentasjonarfunksjonen autosamandrag for å senda tekst til presentasjonardisposisjonar; senda til presentasjonartekst; kopiera med dra og sleppdra og slepp; kopiera og lima inn tekstsetja inn;data frå tekstdokumentkopiera;data frå tekstdokumentlima inn;data frå tekstdokument" #: copytext2application.xhp msgctxt "" "copytext2application.xhp\n" "hd_id3152924\n" "3\n" "help.text" msgid "Inserting Data From Text Documents" msgstr "Setja inn data frå tekstdokument" #: copytext2application.xhp msgctxt "" "copytext2application.xhp\n" "par_id3156426\n" "4\n" "help.text" msgid "You can insert text into other document types, such as spreadsheets and presentations. Note that there is a difference between whether the text is inserted into a text frame, a spreadsheet cell, or into the outline view of a presentation." msgstr "Du kan setja inn tekst i andre dokumenttypar, som for eksempel rekneark og presentasjonar. Ver merksam på at det er skilnad på om du set inn tekst i eit tekstfelt, i ei reknearkcelle og i disposisjonsvising i ein presentasjon." #: copytext2application.xhp msgctxt "" "copytext2application.xhp\n" "par_id3147576\n" "5\n" "help.text" msgid "If you copy text to the clipboard, you can paste it with or without text attributes. Use the shortcut keys CommandCtrl+C to copy and CommandCtrl+V to paste." msgstr "Viss du kopierer tekst til utklippstavla, kan du lima han inn med eller utan teksteigenskapar. Bruk snartastane Cmd Ctrl + C for å kopiera og Cmd Ctrl+ V for å lima inn." #: copytext2application.xhp msgctxt "" "copytext2application.xhp\n" "par_id3152349\n" "help.text" msgid "Icon" msgstr "Ikon" #: copytext2application.xhp msgctxt "" "copytext2application.xhp\n" "par_id3158430\n" "12\n" "help.text" msgid "To select the format in which the clipboard contents will be pasted, click the arrow next to the Paste icon on the Standard bar, or choose Edit - Paste Special, then select the proper format." msgstr "Du kan velja formatet som skal brukast på innhaldet frå utklippstavla når du limer det inn ved å trykka på pila ved sida av knappen Lim inn på standardverktøylinja eller ved å velja Rediger → Lim inn utval og deretter velja formatet du vil bruka." #: copytext2application.xhp msgctxt "" "copytext2application.xhp\n" "par_id3156155\n" "6\n" "help.text" msgid "If a text document contains headings formatted with the Heading Paragraph Style, choose File - Send - Outline to Presentation. A new presentation document is created, which contains the headings as an outline." msgstr "Viss eit tekstdokument inneheld overskrifter som er formaterte med avsnittsstilen Overskrift, vel du Fil → Send → Ein disposisjon til ein presentasjon. Nå vert det laga ein ny presentasjon som inneheld overskrifta som ein disposisjon." #: copytext2application.xhp msgctxt "" "copytext2application.xhp\n" "par_id3145316\n" "9\n" "help.text" msgid "If you want to transfer each heading together with its accompanying paragraphs, select the File - Send - AutoAbstract to Presentation command. You must have formatted the headings with a corresponding Paragraph Style to be able to see this command." msgstr "Viss du vil overføra kvar overskrift saman med dei tilhøyrande avsnitta, vel du Fil → Send → Autosamandrag til presentasjon. Denne kommandoen er berre tilgjengeleg for overskrifter du har formatert med ein av dei tilhøyrande avsnittsstilane." #: copytext2application.xhp msgctxt "" "copytext2application.xhp\n" "hd_id3156024\n" "10\n" "help.text" msgid "Copying Text Using Drag-and-Drop" msgstr "Kopiera tekst med dra og slepp" #: copytext2application.xhp msgctxt "" "copytext2application.xhp\n" "par_id3147303\n" "7\n" "help.text" msgid "If you select text and drag it into a spreadsheet with drag-and-drop, it will be inserted as text into the cell where you release the mouse." msgstr "Viss du merker tekst og bruker dra og slepp for å setja han inn i eit rekneark, vert teksten sett inn i kvar celle som du slepp museknappen i." #: copytext2application.xhp msgctxt "" "copytext2application.xhp\n" "par_id3149655\n" "8\n" "help.text" msgid "If you drag text to the normal view of a presentation, an OLE object is inserted as a $[officename] plug-in." msgstr "Viss du drar tekst til normalvisinga i ein presentasjon, vert eit OLE-objekt sett inn som eit $[officename]-programtillegg." #: copytext2application.xhp msgctxt "" "copytext2application.xhp\n" "par_id3150793\n" "11\n" "help.text" msgid "If you drag the text to the outline view of a presentation, it will be inserted at the cursor location." msgstr "Viss du drar tekst til disposisjonsvisinga i ein presentasjon, vert han sett inn der musepeikaren er plassert." #: ctl.xhp msgctxt "" "ctl.xhp\n" "tit\n" "help.text" msgid "Languages Using Complex Text Layout" msgstr "Språk som brukar kompleks tekstvising (CTL)" #: ctl.xhp msgctxt "" "ctl.xhp\n" "bm_id3153662\n" "help.text" msgid "CTL;complex text layout languageslanguages;complex text layouttext;CTL languagestext layout for special languagesright-to-left textentering text from right to leftbi-directional writingHindi;entering textHebrew;entering textArabic;entering textThai;entering text" msgstr "CTL;språk med kompleks tekstutformingspråk;komplekst tekstutsjånadtekst;CTL-språktekstutsjånad for spesielle språkhøgre-til-venstre-tekstskriva inn tekst frå høgre til venstreTovegs-skrivinghindi;skriva inn teksthebraisk;skriva inn tekstarabisk;skriva inn tekstthai;skriva inn tekst" #: ctl.xhp msgctxt "" "ctl.xhp\n" "hd_id3153662\n" "13\n" "help.text" msgid "Languages Using Complex Text Layout" msgstr "Språk som brukar kompleks tekstvising (CTL)" #: ctl.xhp msgctxt "" "ctl.xhp\n" "par_id3147618\n" "10\n" "help.text" msgid "Currently, $[officename] supports Hindi, Thai, Hebrew, and Arabic as CTL languages." msgstr "$[officename] støtter hindi, thai, hebraisk og arabisk som språk som brukar kompleks tekst." #: ctl.xhp msgctxt "" "ctl.xhp\n" "par_id3155420\n" "11\n" "help.text" msgid "If you select the text flow from right to left, embedded Western text still runs from left to right. The cursor responds to the arrow keys in that Right Arrow moves it \"to the text end\" and Left Arrow \"to the text start\"." msgstr "Viss du vel tekstflyt frå høgre til venstre, vert inkludert vestleg tekst likevel vist frå venstre til høgre. Skrivemerket responderer på piltastane slik at høgrepila flytter skrivemerket til slutten av teksten og venstrepila til byrjinga av teksten." #: ctl.xhp msgctxt "" "ctl.xhp\n" "par_id3145609\n" "1\n" "help.text" msgid "You can change the text writing direction directly be pressing one of the following keys:" msgstr "Du kan endra skriveretninga for teksten ved å bruka ein av desse tastekombinasjonane:" #: ctl.xhp msgctxt "" "ctl.xhp\n" "par_id3154758\n" "2\n" "help.text" msgid "CommandCtrl+Shift+D or CommandCtrl+Right Shift Key - switch to right-to-left text entry" msgstr "CmdCtrl + Shift + D eller CmdCtrl + Høgre Shift → set tekstretninga frå høgre til venstre" #: ctl.xhp msgctxt "" "ctl.xhp\n" "par_id3149047\n" "3\n" "help.text" msgid "CommandCtrl+Shift+A or CommandCtrl+Left Shift Key - switch to left-to-right text entry" msgstr "CmdCtrl + Shift + A eller CmdCtrl + Venstre Shift → set tekstretninga frå venstre til høgre" #: ctl.xhp msgctxt "" "ctl.xhp\n" "par_id3149656\n" "4\n" "help.text" msgid "The modifier-only key combinations only work when CTL support is enabled." msgstr "Tastekombinasjonane verkar berre når støtte for CTL er slått på." #: ctl.xhp msgctxt "" "ctl.xhp\n" "par_id3150541\n" "5\n" "help.text" msgid "In multicolumn pages, sections or frames that are formatted with text flow from right to left, the first column is the right column and the last column is the left column." msgstr "I sider med fleire spalter der bolkar eller rammer er formaterte med tekstflyten frå høgre mot venstre, er den første spalta den høgre spalta og den siste spalta er den venstre spalta." #: ctl.xhp msgctxt "" "ctl.xhp\n" "par_id3148797\n" "6\n" "help.text" msgid "In $[officename] Writer text formatted in Thai language has the following features:" msgstr "I $[officename] Writer-tekst formatert som Thai har desse eigenskapane:" #: ctl.xhp msgctxt "" "ctl.xhp\n" "par_id3156280\n" "7\n" "help.text" msgid "In paragraphs with justified alignment, the characters are stretched to flush the lines at the margins. In other languages the spaces between words are stretched." msgstr "I avsnitt med like margar er teikna strekte ut til ut til margane. I andre språk er mellomromma mellom orda strekte." #: ctl.xhp msgctxt "" "ctl.xhp\n" "par_id3154909\n" "8\n" "help.text" msgid "Use the Delete key to delete a whole composite character. Use the Backspace key to delete the last part of the previous composite character." msgstr "Bruk tasten Delete for å sletta eit heilt samansett teikn. Bruk rettetasten for å sletta den siste delen av det førre samansette teiknet." #: ctl.xhp msgctxt "" "ctl.xhp\n" "par_id3149809\n" "9\n" "help.text" msgid "Use the Right or Left Arrow key to jump to the next or previous whole composite character. To position the cursor into a composite character, use OptionAlt+Arrow key." msgstr "Bruk Pil høgre eller Pil venstre for å bytta til neste eller førre hele samansette teikn. For å plassera skrivemerket inni eit samansett teikn, brukTilvalAlt + Piltast." #: ctl.xhp msgctxt "" "ctl.xhp\n" "par_id3145786\n" "12\n" "help.text" msgid "%PRODUCTNAME - PreferencesTools - Options - Language Settings - Languages" msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Vis" #: ctl.xhp msgctxt "" "ctl.xhp\n" "par_id3153770\n" "14\n" "help.text" msgid "%PRODUCTNAME - PreferencesTools - Options - Language Settings - Complex Text Layout" msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Utsjånad" #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "tit\n" "help.text" msgid "Registering an Address Book" msgstr "Registrera ei adressebok" #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "bm_id3152823\n" "help.text" msgid "data sources; registering address booksaddress books; registeringsystem address book registrationregistering; address books" msgstr "datakjelder; registrera adressebøkeradressebøker; registreraregistrera systemadressebokregistrera; adressebøker" #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "hd_id3154228\n" "2\n" "help.text" msgid "Registering an Address Book" msgstr "Registrera ei adressebok" #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "par_id3154927\n" "3\n" "help.text" msgid "In %PRODUCTNAME you can register different data sources. The contents of the data fields are then available to you for use in various fields and controls. Your system address book is such a data source." msgstr "I %PRODUCTNAME kan du registrera ulike datakjelder. Då vert innhaldet i datafelta tilgjengeleg for bruk i ulike felt og kontrollelement. Systemadresseboka er ei slik datakjelde." #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "par_id3149346\n" "4\n" "help.text" msgid "%PRODUCTNAME templates and wizards use fields for the contents of the address book. When activated, the general fields in the templates are automatically replaced with the fields from the data source of your address book." msgstr "Malar og vegvisarar i %PRODUCTNAME brukar felt som innhald i adresseboka. Når dei er slått på, vert dei generelle felta i malane automatisk erstatta med adresseboka sine felt." #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "par_id3147399\n" "5\n" "help.text" msgid "In order for the replacement to take place, you must tell %PRODUCTNAME which address book you use. The wizard asking for this information appears automatically the first time you activate, for example, a business letter template. You can also call the wizard by following the steps listed below." msgstr "For at ei slik byting skal skje, må du velja kva adressebok du vil at %PRODUCTNAME skal bruka. Vegvisaren som spør om disse opplysingane vert vist automatisk første gongen du slår på ein mal, for eksempel ein mal for eit forretningsbrev. Du kan også starta vegvisaren ved å gå gjennom stega nedanfor." #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "par_id5941648\n" "help.text" msgid "The address book data is read-only in %PRODUCTNAME Base. It is not possible to add, edit, or delete address data from within Base." msgstr "Adressebokdataane er skriveverna i %PRODUCTNAME Base. Du kan ikkje leggja til, redigera eller sletta adressedata når du brukar Base." #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "hd_id3149096\n" "35\n" "help.text" msgid "Address Data Source Wizard" msgstr "Kjelde for adressedata" #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "par_id3147008\n" "36\n" "help.text" msgid "To call the Address Data Source wizard, choose File - Wizards - Address Data Source." msgstr "Du kan bruke vegvisaren Kjelde for adressedata ved å velja Fil → Vegvisar → Kjelde for adressedata." #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "hd_id3149811\n" "6\n" "help.text" msgid "Registering An Existing Address Book Manually" msgstr "Registrera ei eksisterande adressebok manuelt" #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "par_id3150771\n" "8\n" "help.text" msgid "Choose Tools - Address Book Source. The Templates: Address Book Assignment dialog appears." msgstr "Vel Verktøy → Kjelde for adressebok for å opna dialogvindauget Malar: Adresseboktilknyting." #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "par_id3148491\n" "10\n" "help.text" msgid "In the Data source combo box, select the system address book or the data source you want to use as an address book." msgstr "I kombinasjonsboksen Datakjelde vel du systemadresseboka eller datakjelda du vil bruka som adressebok." #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "par_id3149669\n" "11\n" "help.text" msgid "If you have not yet registered the system address book in %PRODUCTNAME as the data source, click the Address Data Source ... button. This takes you to the Address Book Data Source Wizard, in which you can register your address book as a new data source in %PRODUCTNAME." msgstr "Viss du ikkje har registrert systemadresseboka i %PRODUCTNAME som datakjelde, klikk på knappen Adressedatakjelder … som vil opna dialogvindauget Vegvisar for datakjelde til adressebok der du kan registrera adresseboka som ei ny datakjelde i %PRODUCTNAME." #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "par_id3154365\n" "13\n" "help.text" msgid "In the Table combo box, select the database table you want to use as the address book." msgstr "Vel databasetabellen du vi bruka som adressebok i kombinasjonsboksen Tabell." #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "par_id3147084\n" "15\n" "help.text" msgid "Under Field assignment, match the fields for first name, company, department, and so on to the actual field names used in your address book." msgstr "Under Tildeling av felt tilpassar du felta for fornamn, firma, avdeling og så vidare, slik at dei stemmer med feltnamna som er brukte i adresseboka." #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "par_idN10784\n" "help.text" msgid "When finished, close the dialog with OK." msgstr "Når du er ferdig, lukker du dialogvindauget ved å trykka på OK." #: data_addressbook.xhp msgctxt "" "data_addressbook.xhp\n" "par_id3149983\n" "18\n" "help.text" msgid "Now your data source is registered in %PRODUCTNAME as the address book. If you now open a template from the Business Correspondence category, %PRODUCTNAME can automatically insert the correct fields for a form letter." msgstr "Nå er datakjelda registrert som adressebok i %PRODUCTNAME. Viss du nå opnar ein mal i kategorien Forretningskorrespondanse, kan %PRODUCTNAME automatisk setja inn dei rette felta for eit fletta brev." #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "tit\n" "help.text" msgid "Importing and Exporting Data in Text Format" msgstr "Importera og eksportera data i tekstformat" #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "bm_id3157896\n" "help.text" msgid "databases; text formatstext formats; databasesimporting; tables in text formatexporting; spreadsheets to text format" msgstr "databasar; tekstformattekstformat; databasarimportera; tabellar i tekstformateksportera; rekneark til tekstformat" #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "hd_id3154824\n" "55\n" "help.text" msgid "Importing and Exporting Data in Text Format" msgstr "Importera og eksportera data i tekstformat" #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "par_id3147088\n" "54\n" "help.text" msgid "If you want to exchange data with a database that does not have an ODBC link and does not allow dBASE import and export, you can use a common text format." msgstr "Viss du ønskjer å utveksla data med ein database som ikkje har ei ODBC-kopling og som ikkje tillet import og eksport frå og til dBASE, kan du bruka eit vanleg tekstformat." #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "hd_id3145313\n" "41\n" "help.text" msgid "Importing Data into $[officename]" msgstr "Importera data til $[officename]" #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "par_id3147275\n" "40\n" "help.text" msgid "To exchange data in a text format use the $[officename] Calc import/export filter." msgstr "Viss du vil utveksla data i eit tekstformat, kan du bruka import-/eksportfilteret i $[officename] Calc." #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "par_id3145382\n" "42\n" "help.text" msgid "Export the desired data from the source database in a text format. The CSV text format is recommended. This format separates data fields by using delimiters such as commas or semi-colons, and separates records by inserting line breaks." msgstr "Eksporter dei ønskte dataane frå kjeldedatabasen i eit tekstformat. Tekstformatet CSV er tilrådd. Dette formatet skil datafelta med skiljeteikn som kolon eller semikolon, og skil postar frå kvarandre ved å setja inn linjeskift." #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "par_id3153821\n" "43\n" "help.text" msgid "Choose File - Open and click the file to import." msgstr "Vel Fil → Opna og merk fila du vil importera." #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "par_id1977904\n" "help.text" msgid "Select \"Text CSV\" from the File type combo box. Click Open." msgstr "Vel «Tekst, CSV» i kombinasjonsboksen Filtype og vel Opna." #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "par_id3150771\n" "44\n" "help.text" msgid "The Text Import dialog appears. Decide which data to include from the text document." msgstr "Dialogvindauget Tekstimport kjem fram. Bestem deg for kva data du vil ta med frå tekstdokumentet." #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "par_id3150986\n" "45\n" "help.text" msgid "Once the data is in a $[officename] Calc spreadsheet, you can edit it as needed. Save the data as a $[officename] data source:" msgstr "Når dataane er i eit $[officename] Calc-rekneark, kan du redigera reknearket etter behov. Lagra dataane som ei datakjelde i $[officename]:" #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "par_id3149762\n" "56\n" "help.text" msgid "Save the current $[officename] Calc spreadsheet in dBASE format in the folder of a dBASE database. To do this, choose File - Save As, then select the File type \"dBASE\" and the folder of the dBASE database." msgstr "Lagra det gjeldande $[officename] Calc-reknearket i dBASE-format i mappa til ein dBASE-database. Dette gjer du ved å velja Fil → Lagra som, velja «dBASE» som Filtype og lagra i mappa som inneheld dBASE-databasen." #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "hd_id3150400\n" "58\n" "help.text" msgid "Exporting in CSV Text Format" msgstr "Eksportera i CSV-tekstformat" #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "par_id3154140\n" "59\n" "help.text" msgid "You can export the current $[officename] spreadsheet in a text format which can be read by many other applications." msgstr "Du kan eksportera det gjeldande $[officename]-reknearket i eit tekstformat som kan lesast av mange andre program." #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "par_id3152933\n" "60\n" "help.text" msgid "Choose File - Save as." msgstr "Vel Fil → Lagra som." #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "par_id3154216\n" "61\n" "help.text" msgid "In File type select the filter \"Text CSV\". Enter a file name and click Save." msgstr "Vel «Tekst, CSV» som filter i Filtype. Skriv inn eit filnamn og trykk på Lagra." #: data_dbase2office.xhp msgctxt "" "data_dbase2office.xhp\n" "par_id3154908\n" "62\n" "help.text" msgid "This opens the Export of text files dialog, in which you can select the character set, field delimiter and text delimiter. Click OK. A warning informs you that only the active sheet was saved." msgstr "Dette opnar dialogvindauget Eksport av tekstfiler der du kan velja teiknsett og felt- og tekstskiljeteikn. Trykk OK. Det kjem fram ei åtvaring om at berre gjeldande skjema vart lagra." #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "tit\n" "help.text" msgid "Executing SQL Commands" msgstr "Køyra SQL-kommandoar" #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "bm_id3152801\n" "help.text" msgid "SQL; executing SQL commands queries;creating in SQL view commands;SQL executing SQL commands" msgstr "SQL; køyra SQL-kommandoarspørjingar;laga i SQL-visingkommandoar;SQLkøyra;SQL-kommandoar" #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "hd_id3152801\n" "67\n" "help.text" msgid "Executing SQL Commands" msgstr "Utføra SQL-kommandoar" #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "par_id3147008\n" "68\n" "help.text" msgid "With the help of SQL commands you can control the database directly, and can also create and edit tables and queries." msgstr "Ved hjelp av SQL-kommandoar kan du styra databasen direkte, og du kan også laga og redigera tabellar og spørjingar." #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "par_id3153562\n" "72\n" "help.text" msgid "Not all database types support all SQL instructions. If necessary, find out which SQL commands are supported by your database system." msgstr "Ikkje alle databasetypar støttar alle SQL-uttrykka. Om nødvendig bør du undersøkja kva SQL-kommandoar som vert støtta av databasesystemet du brukar." #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "hd_id9577929\n" "help.text" msgid "To execute an SQL statement directly" msgstr "Slik utfører du eit SQL-uttryk direkte" #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "par_id7923825\n" "help.text" msgid "Choose File - Open to open a database file." msgstr "Vel Fil → Opna for å opna ei databasefil." #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "par_id9448530\n" "help.text" msgid "Choose Tools - SQL." msgstr "Vis Fil → Opna." #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "par_id3151176\n" "91\n" "help.text" msgid "Click the Create Query in SQL View icon Icon or" msgstr "Trykk på Lag spørjing i SQL-vising Ikon eller" #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "par_id3145786\n" "92\n" "help.text" msgid "Select an existing query from the list and click the Edit icon Icon." msgstr "Vel ei eksisterande spørjing frå lista og klikk på ikonet Rediger Ikon." #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "par_id3083443\n" "94\n" "help.text" msgid "In the Query window, choose View - Switch Design View On/Off. Edit the SQL command." msgstr "I spørjingsvindauget vel du Vis → Slå på/av utformingsvising. Rediger SQL-kommandoen." #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "par_id3152460\n" "96\n" "help.text" msgid "Click the Run icon Icon. The result of the query is displayed in the upper window." msgstr "Trykk på Køyr Ikon. Resultatet av spørjinga vert vist i det øvre vindauget." #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "par_id3149298\n" "98\n" "help.text" msgid "Click the Save or Save As icon Icon to save the query." msgstr "Trykk knappen Lagra eller Lagra som Ikon for å lagra spørjinga." #: data_enter_sql.xhp msgctxt "" "data_enter_sql.xhp\n" "par_id3153223\n" "105\n" "help.text" msgid "Query Design" msgstr "Spørjingsutforming" #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "tit\n" "help.text" msgid "Working with Forms" msgstr "Arbeida med skjema" #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "bm_id5762199\n" "help.text" msgid "opening;formsforms;creatingdesign view;creating forms" msgstr "opna;skjemaskjema;lagautformingsvising;laga skjema" #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "par_idN105F9\n" "help.text" msgid "Working with Forms" msgstr "Arbeida med skjema" #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "par_idN10617\n" "help.text" msgid "Using forms, you can define how to present the data. Open a text document or a spreadsheet and insert the controls such as push buttons and list boxes. In the properties dialogs of the controls, you can define what data the forms should display." msgstr "Når du brukar skjema kan du bestemma korleis dataane skal visast. Opna eit tekstdokument eller eit rekneark og set inn kontrollelementa du vil bruka, for eksempel trykknappar og listeboksar. Kvart kontrollelement har eit dialogvindauge for eigenskapar som du kan bruka til å velja kva data som skal visast i skjemaa." #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "par_idN1061A\n" "help.text" msgid "Creating a New Form With the Form Wizard" msgstr "Laga eit nytt skjema ved hjelp av skjemavegvisaren" #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "par_idN1061E\n" "help.text" msgid "In %PRODUCTNAME, you can create a new form using the Form Wizard:" msgstr "I %PRODUCTNAME du kan laga eit nytt skjema ved å bruka skjemavegvisaren:" #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "par_idN10632\n" "help.text" msgid "Open the database file where you want to create the new form." msgstr "Opna databasefila der du vil laga det nye skjemaet." #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "par_idN10636\n" "help.text" msgid "In the left pane of the database window, click the Forms icon." msgstr "Klikk på ikonet Skjema i det venstre feltet i databasevindauget." #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "par_idN1063E\n" "help.text" msgid "Click Use Wizard to Create Form." msgstr "Trykk på Lag skjema med vegvisar." #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "par_idN10645\n" "help.text" msgid "Creating a New Form Manually" msgstr "Laga eit nytt skjema manuelt" #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "par_idN1064C\n" "help.text" msgid "Open the database file where you want to create the new form." msgstr "Opna databasefila der du vil laga det nye skjemaet. " #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "par_idN10650\n" "help.text" msgid "In the left pane of the database window, click the Forms icon." msgstr "Klikk på ikonet Skjema i det venstre feltet i databasevindauget." #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "par_idN10658\n" "help.text" msgid "Click Create Form in Design View." msgstr "Trykk på Lag skjema i utformingsvising." #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "par_idN1065F\n" "help.text" msgid "A new text document opens. Use the Form Controls to insert form controls." msgstr "Eit nytt tekstdokument vert opna. Bruk verktøylinja Kontrollelement for skjema til å setja inn kontrollelement i skjemaet." #: data_forms.xhp msgctxt "" "data_forms.xhp\n" "par_idN10670\n" "help.text" msgid "Click the Forms icon to access all forms that were created from within the current database window. In addition, you can use the Form Controls icons to add database form controls to any Writer or Calc document, but these documents will not be listed in the database window." msgstr "Trykk på Skjema for å få tilgang til alle skjema som er laga ved hjelp av det gjeldande databasevindauget. Du kan også bruka knappane på verktøylinja Kontrollelement for skjema til å leggja til kontrollelement for databaseskjema i kva Writer- eller Calc-dokument som helst, men desse dokumenta vert ikkje viste i lista i databasevindauget." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "tit\n" "help.text" msgid "Importing and Exporting Data in Base" msgstr "Importera og eksportera data i Base" #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "bm_id6911546\n" "help.text" msgid "databases;importing/exportingimporting;databasescopying; datasource records in spreadsheetsinserting; datasource records in spreadsheetsspreadsheets;inserting database recordsdata sources;copying records to spreadsheetspasting;from data sources to %PRODUCTNAME Calc" msgstr "databasar;importera/eksporteraimportera;databasarkopiere; datakjeldepostar i reknearksetja inn; datakjeldepostar i reknearkrekneark;setja inn datakjeldepostardatakjelder;kopiera postar til reknearklima inn;frå datakjelder til %PRODUCTNAME Calc" #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "hd_id4547257\n" "help.text" msgid "Importing and Exporting Data in Base" msgstr "Importera og eksportera data i Base" #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id2761314\n" "help.text" msgid "An easy method to import and export database tables uses Calc as a \"helper application\"." msgstr "Ein enkel metode du kan bruka til å importera og eksportera databasetabellar, er å bruka Calc som eit «hjelpeprogram»." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "hd_id3912778\n" "help.text" msgid "Exporting data from Base" msgstr "Eksportera data frå Base" #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id3163853\n" "help.text" msgid "You copy a table from Base to a new Calc sheet, then you can save or export the data to any file format that Calc supports." msgstr "Kopier ein tabell frå Base til eit nytt ark i Calc. Deretter kan du lagra eller eksportera dataane til eit filformat som Calc støttar." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id121158\n" "help.text" msgid "Open the database file that contains the database table to be exported. Click Tables to view the tables, or click Queries to view the queries." msgstr "Opna databasefila som inneheld databasetabellen du vil eksportera. Trykk på Tabellar for å vise tabellane, eller trykk på Spørjingar for å visa spørjingane." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id4644306\n" "help.text" msgid "Choose File - New - Spreadsheet." msgstr "Vel Fil → Ny → Rekneark." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id1331217\n" "help.text" msgid "In the Base window, right-click the name of the table to export. Choose Copy from the context menu." msgstr "Høgreklikk på namnet til tabellen du vil eksportera i Base-vindauget. Vel Kopier i sprettoppmenyen." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id3806878\n" "help.text" msgid "Click cell A1 in the new Calc window, then choose Edit - Paste." msgstr "Klikk i celle A1 i det nye Calc-vindauget og vel Rediger → Lim inn." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id130619\n" "help.text" msgid "Now you can save or export the data to many file types." msgstr "Nå kan du lagra eller eksportera dataane til mange ulike filtypar." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "hd_id9999694\n" "help.text" msgid "Importing data to Base" msgstr "Importera data til Base" #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id8494521\n" "help.text" msgid "You can import text files, spreadsheet files, and your system address book in read-only mode only." msgstr "Du kan importera tekstfiler, reknearkfiler og systemadresseboka berre i skriveverna modus." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id9579760\n" "help.text" msgid "When you import from a text or spreadsheet file, the file must have a first row of header information. The second row of the file is the first valid data row. The format of every field in the second row determines the format for the entire column. Any format information from a spreadsheet file gets lost when importing to Base." msgstr "Når du importerer frå ei tekstfil eller en reknearkfil, må den første rada i fila innehalde overskriftsinformasjon. Den andre rada i filen er den første gyldige datarada. Formatet til kvart felt i den andre rada bestemmer formatet for heile kolonnen. All formatinformasjon i reknearkfila forsvinn ved import til Base." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id325632\n" "help.text" msgid "For example, to ensure the first column has a text format, you must make sure that the first field of the first valid data row contains text. If a field in the first valid data row contains a number, the whole column is set to number format, and only numbers, no text, will be shown in that column." msgstr "Viss du for eksempel vil vera sikker på at den første kolonnen har tekstformat, bør du syta for at det første feltet i den første gyldige datarada inneheld tekst. Viss eit felt i den første gyldige datarada inneheld eit tal, får heile kolonnen talformat slik at berre tal vert viste i denne kolonnen, men ingen tekst." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id2216559\n" "help.text" msgid "Open a Base file of the database type that you want." msgstr "Opna ei Base-fil med databasetypen du vil bruka." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id7869502\n" "help.text" msgid "Either create a new Base file using the Database Wizard, or open any existing Base file that is not read-only." msgstr "Du kan anten laga ei ny fil i Base ved hjelp av databasevegvisaren, eller du kan opna ei eksisterande Base-fil som ikkje er skriveverna." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id9852900\n" "help.text" msgid "Open the Calc file that contains the data to be imported to Base. You can open a *.dbf dBASE file or many other file types." msgstr "Opna Calc-fila som inneheld dataane som skal importerast til Base. Du kan opna ei *.dbf dBASE-fil eller mange andre filtypar." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id3791924\n" "help.text" msgid "Select the data to be copied to Base." msgstr "Merk dataane som skal kopierast til Base." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id6173894\n" "help.text" msgid "You can enter a range reference like A1:X500 in the Name Box if you don't want to scroll." msgstr "Du kan skriva inn eit område som A1:X500 i namnefeltet viss du ikkje vil rulle i fila." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id533768\n" "help.text" msgid "If you copy a dBASE sheet, include the top row that contains the header data." msgstr "Viss du kopierer eit dBASE-ark, ta med den øvste rada som inneheld overskriftsdataane." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id5669423\n" "help.text" msgid "Choose Edit - Copy." msgstr "Vel Rediger → Kopier." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id3619495\n" "help.text" msgid "In the Base window, click Tables to view the tables." msgstr "Trykk på Tabellar i Base-vindauget for å visa tabellane." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id1175572\n" "help.text" msgid "In the Base window, choose Edit - Paste." msgstr "Vel Rediger → Lim inn i vindauget i Base." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id4815820\n" "help.text" msgid "You see the Copy Table dialog. Most databases need a primary key, so you may want to check the Create primary key box." msgstr "Dialogvindauget for å kopiera tabellar vert vist. Dei fleste databasane treng ein primærnøkkel, så du må kanskje kryssa av i boksen Lag primærnøkkel." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id2584002\n" "help.text" msgid "On Windows systems, you can also use drag-and-drop instead of Copy and Paste. Also, for registered databases, you can open the datasource browser (press F4) instead of opening the Base window." msgstr "På Windows-system kan du også bruka dra og slepp i staden for kopier og set inn. For registrerte databasar kan du opna datakjeldeutforskaren (trykk F4) i staden for å opna Base-vindauget." #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id5871761\n" "help.text" msgid "" msgstr "" #: data_im_export.xhp msgctxt "" "data_im_export.xhp\n" "par_id6531266\n" "help.text" msgid "" msgstr "" #: data_new.xhp msgctxt "" "data_new.xhp\n" "tit\n" "help.text" msgid "Creating a New Database" msgstr "Laga ein ny database" #: data_new.xhp msgctxt "" "data_new.xhp\n" "bm_id6911526\n" "help.text" msgid "databases;creatingnew databases" msgstr "databasar;laganye databasar" #: data_new.xhp msgctxt "" "data_new.xhp\n" "par_idN105A3\n" "help.text" msgid "Creating a New Database" msgstr "Laga ein ny database" #: data_new.xhp msgctxt "" "data_new.xhp\n" "par_idN105C4\n" "help.text" msgid "Choose File - New - Database." msgstr "Vel Fil → Ny → Database." #: data_new.xhp msgctxt "" "data_new.xhp\n" "par_idN105CB\n" "help.text" msgid "This opens the Database Wizard, where you create a new database file." msgstr "Dette vil opna databasevegvisaren, som kan brukast til å laga ei ny databasefil." #: data_new.xhp msgctxt "" "data_new.xhp\n" "par_idN105DD\n" "help.text" msgid "In the Database Wizard, select the type of database, and select the option to open the Table Wizard as the next wizard." msgstr "Vel databasetype i databasevegvisaren og innstillingane for å opna tabellvegvisaren som den neste vegvisaren." #: data_new.xhp msgctxt "" "data_new.xhp\n" "par_idN105E0\n" "help.text" msgid "The Table Wizard helps you to add a table to the new database file." msgstr "Tabellvegvisaren hjelper deg med å leggja til ein tabell i ei ny databasefil." #: data_new.xhp msgctxt "" "data_new.xhp\n" "par_idN105FC\n" "help.text" msgid "" msgstr "" #: data_new.xhp msgctxt "" "data_new.xhp\n" "par_idN10604\n" "help.text" msgid "" msgstr "" #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "tit\n" "help.text" msgid "Working with Queries" msgstr "Arbeida med spørjingar" #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "bm_id840784\n" "help.text" msgid "databases;creating queriesfiltering;data in databasesqueries;defining (Base)defining;queries (Base)wizards;database queriesQuery Wizard (Base)" msgstr "databasar;laga spørjingarfiltrera;data i databasarspørjingar;definera (Base)definera;spørjingar (Base)vegvisarar;database-spørjingarspørjingsvegvisar (Base)" #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN105F9\n" "help.text" msgid "Working with Queries" msgstr "Arbeida med spørjingar" #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN10617\n" "help.text" msgid "If you often want to access only a subset of your data that can be well defined by a filter condition, you can define a query. This is basically a name for the new view at the filtered data. You open the query and see the current data in the table layout that you defined." msgstr "Viss du ofte ønskjer tilgang til berre ei delmengd av dataane dine som kan definerast av eit filtervilkår, kan du definera ei spørjing. Dette er ein annan måte å visa filtrerte data på. Du opnar spørjinga og får fram dei aktuelle dataane i den nye tabellutforminga." #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN1061A\n" "help.text" msgid "Creating a New Query With the Query Wizard" msgstr "Laga ei ny spørjing med vegvisaren for spørjingar" #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN1061E\n" "help.text" msgid "In %PRODUCTNAME you can create a new query using the Query Wizard:" msgstr "I %PRODUCTNAME kan du laga ei ny spørjing ved å bruka Vegvisar for spørjingar:" #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN10632\n" "help.text" msgid "Open the database file where you want to create the new query." msgstr "Opna databasefila som du vil laga den nye spørjinga i." #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN10636\n" "help.text" msgid "In the left pane of the database window, click the Queries icon." msgstr "Trykk på Spørjingar i det venstre feltet i databasevindauget." #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN1063E\n" "help.text" msgid "Click Use Wizard to Create Query." msgstr "Trykk på Lag spørjing med vegvisar." #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN10645\n" "help.text" msgid "Creating a New Query With the Design View" msgstr "Laga ei ny spørjing i utformingsvising" #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN1064C\n" "help.text" msgid "Open the database file where you want to create the new query." msgstr "Opna databasefila som du vil laga den nye spørjinga i." #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN10650\n" "help.text" msgid "In the left pane of the database window, click the Queries icon." msgstr "Trykk på Spørjingar i det venstre feltet i databasevindauget." #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN10658\n" "help.text" msgid "Click Create Query in Design View." msgstr "Trykk på Lag spørjing i utformingsvising." #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN1065F\n" "help.text" msgid "You see the Query Design window." msgstr "Vindauget spørjingsutforming vert opna." #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN1067B\n" "help.text" msgid "" msgstr "" #: data_queries.xhp msgctxt "" "data_queries.xhp\n" "par_idN10683\n" "help.text" msgid "" msgstr "" #: data_register.xhp msgctxt "" "data_register.xhp\n" "tit\n" "help.text" msgid "Registering and Deleting a Database" msgstr "Registrera og sletta ein database" #: data_register.xhp msgctxt "" "data_register.xhp\n" "bm_id4724570\n" "help.text" msgid "databases;registering (Base)registering;databases (Base)deleting;databases (Base)databases;deleting (Base)lists;registered databases (Base)" msgstr "databasar;registrera (Base)registrera;databasar (Base)slette;databasar (Base)databasar;slette (Base)lister;registrerte databasar (Base)" #: data_register.xhp msgctxt "" "data_register.xhp\n" "par_idN105A3\n" "help.text" msgid "Registering and Deleting a Database" msgstr "Registrera og sletta ein database" #: data_register.xhp msgctxt "" "data_register.xhp\n" "par_idN105C1\n" "help.text" msgid "Data from any database file can be registered to %PRODUCTNAME. To register means to tell %PRODUCTNAME where the data is located, how it is organized, how to get that data, and more. Once the database is registered, you can use the menu command View - Data source to access the data records from your text documents and spreadsheets." msgstr "Data frå kva databasefil som helst kan registrerast i %PRODUCTNAME. Å registrera ein database betyr at du fortel %PRODUCTNAME kvar dataane er plasserte, korleis dei er organiserte, korleis dei kan hentast og så vidare. Når databasen er registrert, kan du bruka Vis → Datakjelde i menyen for å få tilgang til datapostane frå tekstdokument og rekneark." #: data_register.xhp msgctxt "" "data_register.xhp\n" "par_idN105C8\n" "help.text" msgid "To register an existing database file:" msgstr "Slik registrerer du ei eksisterande databasefil:" #: data_register.xhp msgctxt "" "data_register.xhp\n" "par_idN105CF\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME Base - Databases." msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Vis" #: data_register.xhp msgctxt "" "data_register.xhp\n" "par_idN105E1\n" "help.text" msgid "Click New and select the database file." msgstr "Trykk på Ny og merk databasefila." #: data_register.xhp msgctxt "" "data_register.xhp\n" "par_idN10700\n" "help.text" msgid "To remove a registered database from %PRODUCTNAME" msgstr "Fjerna ein registrert database frå %PRODUCTNAME" #: data_register.xhp msgctxt "" "data_register.xhp\n" "par_idN10707\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME Base - Databases." msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Vis" #: data_register.xhp msgctxt "" "data_register.xhp\n" "par_idN10719\n" "help.text" msgid "Select the database file and click Delete." msgstr "Merk databasefila og trykk på Slett." #: data_register.xhp msgctxt "" "data_register.xhp\n" "par_idN105F3\n" "help.text" msgid "" msgstr "" #: data_register.xhp msgctxt "" "data_register.xhp\n" "par_idN105FB\n" "help.text" msgid "" msgstr "" #: data_report.xhp msgctxt "" "data_report.xhp\n" "tit\n" "help.text" msgid "Using and Editing Database Reports" msgstr "Bruka og redigera databaserapportar" #: data_report.xhp msgctxt "" "data_report.xhp\n" "bm_id3147834\n" "help.text" msgid "database reportsdata sources;reportsreports;opening and editingediting;reportsopening;reportstemplates;database reportsreports;templates" msgstr "databaserapportardatakjelder;rapportarrapportar;opna og redigeraredigera;rapportaropna;rapportarmalar;databaserapportarrapportar;malar" #: data_report.xhp msgctxt "" "data_report.xhp\n" "hd_id3149178\n" "1\n" "help.text" msgid "Using and Editing Database Reports" msgstr "Bruka og redigera databaserapportar" #: data_report.xhp msgctxt "" "data_report.xhp\n" "hd_id3145609\n" "13\n" "help.text" msgid "Using a Report" msgstr "Bruka ein rapport" #: data_report.xhp msgctxt "" "data_report.xhp\n" "par_id3147265\n" "14\n" "help.text" msgid "%PRODUCTNAME stores the information about the created reports in the database file." msgstr "%PRODUCTNAME lagrar informasjon om rapportane som er laga i databasefila." #: data_report.xhp msgctxt "" "data_report.xhp\n" "par_id3154758\n" "15\n" "help.text" msgid "Choose File - Open and select the database file." msgstr "Vel Fil → Opna og merk databasefila." #: data_report.xhp msgctxt "" "data_report.xhp\n" "par_id3151054\n" "16\n" "help.text" msgid "In the database file window, click the Reports icon." msgstr "Trykk på Rapportar i det venstre feltet i databasevindauget." #: data_report.xhp msgctxt "" "data_report.xhp\n" "par_id3156280\n" "18\n" "help.text" msgid "Double-click one of the report names to open the report." msgstr "Dobbeltklikk på namnet til ein av rapportane for å opna han." #: data_report.xhp msgctxt "" "data_report.xhp\n" "par_idN1077D\n" "help.text" msgid "These links are added automatically when you create a new report by the Report Wizard or in the Report Builder window." msgstr "Desse referansane vert oppretta automatisk når du lagar ein ny rapport med rapportvegvisaren eller rapportutforminga." #: data_report.xhp msgctxt "" "data_report.xhp\n" "hd_id1695608\n" "help.text" msgid "Editing a Report Created in the Report Builder Window" msgstr "Redigera ein rapport laga i rapportbyggjar-vindauget" #: data_report.xhp msgctxt "" "data_report.xhp\n" "par_id7510910\n" "help.text" msgid "Right-click the name of a report in the database file window, then choose Edit." msgstr "Høgreklikk på namnet til ein av rapportane i databasefilvindauget og vel Rediger." #: data_report.xhp msgctxt "" "data_report.xhp\n" "par_id8138065\n" "help.text" msgid "The Report Builder window opens with the report's information loaded." msgstr "Rapportbyggjar-vindauget vert opna med rapportinformasjonen lasta inn." #: data_report.xhp msgctxt "" "data_report.xhp\n" "par_id5086825\n" "help.text" msgid "Use the toolbars and menu commands and drag-and-drop to edit the report as stated in the Report Builder guide." msgstr "Bruk verktøylinjene og menykommandoane og dra og slepp for å redigera rapporten som omtalt i vegvisaren for rapportbyggjaren." #: data_report.xhp msgctxt "" "data_report.xhp\n" "par_id4747154\n" "help.text" msgid "Execute the report to see the resulting report document." msgstr "Køyr rapporten for å sjå rapportdokumentet." #: data_report.xhp msgctxt "" "data_report.xhp\n" "hd_id3153104\n" "19\n" "help.text" msgid "Editing a Report Created by the Report Wizard" msgstr "Slik redigerer du ein rapport laga med rapportvegvisaren" #: data_report.xhp msgctxt "" "data_report.xhp\n" "par_id3125863\n" "20\n" "help.text" msgid "On the last dialog page of the Report Wizard, you can choose to edit the report template before you use the report." msgstr "På den siste dialogsida i rapportvegvisaren kan du velja å redigera rapportmalen før du brukar rapporten." #: data_report.xhp msgctxt "" "data_report.xhp\n" "par_id3155431\n" "22\n" "help.text" msgid "You can edit the page styles for the first page and the following pages of the report as well as the paragraph styles, the number formats, the printed field labels, and more." msgstr "Du kan redigera sidestilane for den første sida og dei følgjande sidene av rapporten, i tillegg til avsnittstilar, talformat, dei utskrivne feltetikettane med meir." #: data_report.xhp msgctxt "" "data_report.xhp\n" "par_idN107D7\n" "help.text" msgid "Unless you have a thorough understanding of the database the report accesses, do not edit the SQL statement, database name, the hidden form controls, or the related information on the report." msgstr "Du bør ikkje redigera SQL-setninga, databasenamnet, dei gøymde formelarkontrolelementa eller tilsvarande informasjon om rapporten utan at du har god kunnskap om databasar og rapportar." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "tit\n" "help.text" msgid "Creating Reports" msgstr "Laga rapportar" #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "bm_id3729667\n" "help.text" msgid "databases;creating reportsreports;creatingwizards;reports" msgstr "databasar;laga rapportarrapportar;lagavegvisarar;rapportar" #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_idN105A3\n" "help.text" msgid "Creating Reports" msgstr "Laga rapportar" #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_idN105C1\n" "help.text" msgid "A report is a Writer text document that can show your data in an organized order and formatting. In %PRODUCTNAME Base, you have a choice to create a report either manually using drag-and-drop in the Report Builder window, or semi-automatic by following a series of dialogs in the Report Wizard." msgstr "Ein rapport er eit Writer-tekstdokument som kan visa data i ei ordna rekkjefølgje og formatering. I %PRODUCTNAME Base har du valet mellom å laga ein rapport manuelt ved bruk av dra og slepp i rapportbyggjar-vindauget eller halvautomatisk ved å følgja ein serie med dialogvindauge i rapportvegvisaren." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id4094363\n" "help.text" msgid "The following list gives you some information to decide which method to use for your data:" msgstr "Denne lista inneheld informasjon du kan bruka for å bestemma kva metode du bør bruka for dataane dine:" #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id8514358\n" "help.text" msgid "Report Builder" msgstr "Rapportbyggjar" #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id9764091\n" "help.text" msgid "Report Wizard" msgstr "Rapportvegvisar" #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id1579638\n" "help.text" msgid "Started by \"Create Report in Design View\" command." msgstr "Starta med kommandoen «Lag rapport i utformingsvising»." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id1886959\n" "help.text" msgid "Started by \"Use Wizard to Create Report\" command." msgstr "Starta med «Lag rapport med rapportvegvisar»." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id455030\n" "help.text" msgid "Full flexibility to use report headers and footers, page headers and footers, multi-column reports." msgstr "Full fleksibilitet med omsyn til å bruka rapporttopptekstar og rapportbotntekstar, sidetopptekstar og sidebotntekstar og rapportar med fleire spalter." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id8409985\n" "help.text" msgid "Uses a Writer template to generate a report document." msgstr "Brukar ein Writer-mal for å laga eit rapportdokument." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id5931272\n" "help.text" msgid "Use drag-and-drop to position the record fields or other design elements like pictures or lines." msgstr "Bruk dra og slepp for å plassera datapostfelt eller andre utformingselement som bilete eller linjer." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id9869075\n" "help.text" msgid "Select from several given choices to arrange the data records." msgstr "Ordna datapostane gjennom å velja mellom fleire moglege forslag. " #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id8611713\n" "help.text" msgid "Generates a one-time snapshot of the data. To see an updated report, execute the same report again to create a Writer document with the updated data." msgstr "Lagar eit augneblinksbilete av dataane. Ønskjer du å sjå ein oppdatert rapport, køyr den same rapporten igjen for å laga eit nytt Writer-dokument med den nye informasjonen." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id2866908\n" "help.text" msgid "You can choose to generate a one-time snapshot with fixed data, or a \"live\" report with links to the current data at the time when you open the Base file." msgstr "Du kan velja å laga eit statisk bilete med faste data eller ein dynamisk rapport med lenkjer til dei gjeldande dataane som vert oppdaterte når databasen vert opna." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id4169743\n" "help.text" msgid "Saves the report as a Writer text document. Stores the information how to create the report inside the Base file." msgstr "Lagrar rapporten som eit Writer-tekstdokument med informasjon om korleis rapporten kan lagast i databasen." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id408948\n" "help.text" msgid "Saves the report and the information how to create the report inside the Base file." msgstr "Lagrar rapporten og informasjonen om korleis rapporten kan lagast i Base-fila." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id2891933\n" "help.text" msgid "Choose Open in the context menu or double-click the report name to create a new report with the current data." msgstr "Vel «Opna» i sprettoppmenyen eller dobbeltklikk på rapportnamnet for å laga ein ny rapport med dei gjeldande dataane." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id6142765\n" "help.text" msgid "Choose Open in the context menu or double-click the report name to either see again the static snapshot of the data from first creation time, or to create a new report with the current data. This depends on your choice on the last page of the wizard." msgstr "Vel «Opna» i sprettoppmenyen eller dobbeltklikk på rapportnamnet for anten å sjå det statiske augneblinksbiletet eller for å laga ein ny rapport med dei gjeldande dataane. Dette er avhengig av vala du har gjort på den siste sida i vegvisaren." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id1757560\n" "help.text" msgid "Choose Edit in the context menu of a report name to open the Report Builder window, with the report's information loaded." msgstr "Vel «Rediger» i sprettoppmenyen for eit rapportnamn for å opna rapportbyggjar-vindauget med rapportinformasjonen lasta inn." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id4649189\n" "help.text" msgid "Choose Edit in the context menu of a report name to edit the Writer template file that was used to create the report." msgstr "Vel «Rediger» i sprettoppmenyen for eit rapportnamn for å redigera Writer-malfila som vart brukt til å laga rapporten." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "hd_id8414258\n" "help.text" msgid "Creating a New Report Manually In Design View" msgstr "Laga ein ny rapport manuelt i utformingsvising" #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id3119602\n" "help.text" msgid "Open the database file where you want to create the new report." msgstr "Opna databasefila som du vil laga den nye rapporten i." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id4226508\n" "help.text" msgid "In the left pane of the database window, click the Reports icon." msgstr "Trykk på Rapportar i det venstre feltet i databasevindauget." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id5758842\n" "help.text" msgid "Click Create Report in Design View." msgstr "Klikk på Lag rapport i utformingsvising." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id4870754\n" "help.text" msgid "Follow the instructions in the Report Builder guide." msgstr "Følj instruksjonane i vegvisaren Rapportbyggjar." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_idN105C4\n" "help.text" msgid "Creating a New Report With the Report Wizard" msgstr "Laga ein ny rapport med rapportvegvisaren" #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_idN105DC\n" "help.text" msgid "Open the database file where you want to create the new report." msgstr "Opna databasefila som du vil laga den nye rapporten i. " #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_idN105E0\n" "help.text" msgid "In the left pane of the database window, click the Reports icon." msgstr "Trykk på Rapportar i det venstre feltet i databasevindauget." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_idN105E8\n" "help.text" msgid "Click Use Wizard to Create Report." msgstr "Trykk på Lag rapport med vegvisar." #: data_reports.xhp msgctxt "" "data_reports.xhp\n" "par_id8032166\n" "help.text" msgid "Follow the steps of the Report Wizard to create the report." msgstr "Følj stega i rapportvegvisaren for å laga rapporten." #: data_search.xhp msgctxt "" "data_search.xhp\n" "tit\n" "help.text" msgid "Searching Tables and Form Documents" msgstr "Søking i tabellar og skjemadokument" #: data_search.xhp msgctxt "" "data_search.xhp\n" "bm_id4066896\n" "help.text" msgid "finding;records in form documentsforms;finding recordssearching;tables and forms" msgstr "finna;postar i skjemadokumentskjema;finna postarsøkja;tabellar og skjema" #: data_search.xhp msgctxt "" "data_search.xhp\n" "hd_id3154186\n" "64\n" "help.text" msgid "Searching Tables and Form Documents" msgstr "Søking i tabellar og skjemadokument" #: data_search.xhp msgctxt "" "data_search.xhp\n" "par_id3147088\n" "help.text" msgid "Icon" msgstr "Ikon" #: data_search.xhp msgctxt "" "data_search.xhp\n" "par_id3149178\n" "65\n" "help.text" msgid "In spreadsheets and documents in which form controls are used, you can click the Find Record icon on the form bar to open a dialog to find any text and values." msgstr "I rekneark og dokument der skjemakontrollelememt er brukte, kan du klikka på ikonet Søk datapost på skjemaverktøylinja for å opna eit dialogvindauge for å finna kva tekst og verdiar som helst." #: data_search.xhp msgctxt "" "data_search.xhp\n" "par_id3149811\n" "66\n" "help.text" msgid "You can search in one or in all data fields. You can select whether the text must be at the beginning, end or any location of the data field. You also can use the ? and * wildcards, as in the Find & Replace dialog. You can find additional information about the database search function in the $[officename] Help." msgstr "Du kan søka i eitt eller fleire datafelt. Du kan velja om teksten må vera ved byrjinga, slutten eller kvar som helst i datafeltet. Du kan også bruka jokerteikna «?» og «*» på same måten som i dialogvindauget Søk og byt ut. Du kan finna meir informasjon om databasesøkefunksjonen i $[officename] Hjelp." #: data_search2.xhp msgctxt "" "data_search2.xhp\n" "tit\n" "help.text" msgid "Searching With a Form Filter" msgstr "Søke med skjemafilter" #: data_search2.xhp msgctxt "" "data_search2.xhp\n" "bm_id8772545\n" "help.text" msgid "form filtersdatabases;form filterssearching; form filtersremoving;form filtersfiltering; data in formsdata;filtering in formsforms; filtering datadata, see also values" msgstr "skjemafilterdatabasar;skjemafiltersøking; skjemafilterfjerna;skjemafilterfiltrering; data i skjemadata;filtrering i skjemaskjema; filtrere datadata, sjå også verdiar" #: data_search2.xhp msgctxt "" "data_search2.xhp\n" "hd_id3156042\n" "5\n" "help.text" msgid "Searching With a Form Filter" msgstr "Søke med eit skjemafilter" #: data_search2.xhp msgctxt "" "data_search2.xhp\n" "par_id3149182\n" "17\n" "help.text" msgid "Open a form document that contains database fields." msgstr "Opna eit skjemadokument som inneheld databasefelt." #: data_search2.xhp msgctxt "" "data_search2.xhp\n" "par_id3159157\n" "18\n" "help.text" msgid "As an example, open an empty text document and press F4. Open the bibliography database table biblio in the data source view. While pressing Shift+CommandCtrl, drag a few column headers into the document so that the form fields are created." msgstr "Som eit eksempel, opna eit tomt tekstdokument og trykk F4. Opna litteraturdatabasetabellen biblio i datakjeldevisinga. Hald nede Shift + CmdCtrl og dra eit par kolonneoverskrifter inn i dokumentet slik at skjemafelta vert laga." #: data_search2.xhp msgctxt "" "data_search2.xhp\n" "par_id3150984\n" "19\n" "help.text" msgid "On the Form Controls toolbar, click the Design Mode On/Off icon Icon to turn off the design mode." msgstr "Klikk på Utformingsmodus på/av Ikon på verktøylinja Skjema for å slå av utformingstilstanden." #: data_search2.xhp msgctxt "" "data_search2.xhp\n" "par_id3148672\n" "6\n" "help.text" msgid "On the Form Navigation toolbar, click the Form-Based Filters icon Icon. The current document is displayed with its form controls as an empty edit mask. The Form Filter toolbar appears." msgstr "Klikk på symbolet Skjemabaserte filter Ikon på verktøylinja Skjemastruktur. Det gjeldande dokumentet vert vist med skjemakontrollelementa som ei tom redigeringsmaske. Verktøylinja Skjemafiltervert også vist." #: data_search2.xhp msgctxt "" "data_search2.xhp\n" "par_id3149666\n" "7\n" "help.text" msgid "Enter the filter conditions into one or several fields. Note that if you enter filter conditions into several fields, all of the entered conditions must match (Boolean AND)." msgstr "Skriv filtervilkåra i eitt eller fleire felt. Merk at viss du skriv inn filtereigenskapar i fleire felt, må alle vilkåra kunna koplast med logisk OG." #: data_search2.xhp msgctxt "" "data_search2.xhp\n" "par_id3149481\n" "8\n" "help.text" msgid "More information about wildcards and operators can be found in Query Design." msgstr "Du kan finna meir informasjon om jokerteikn og operatorer i Spørjingsutforming." #: data_search2.xhp msgctxt "" "data_search2.xhp\n" "par_id3152462\n" "9\n" "help.text" msgid "If you click the Apply Form-Based Filter icon on the Form Filter toolbar, the filter will be applied. You see the Form Navigation toolbar and can browse through the found records." msgstr "Om du trykkjer på knappen Bruk skjemabasert filter på verktøylinja Skjemafilter, vert filteret teke i bruk. Du får sjå verktøylinja for skjemanavigering og kan søkja gjennom postane som er funne." #: data_search2.xhp msgctxt "" "data_search2.xhp\n" "par_id3145273\n" "10\n" "help.text" msgid "If you click on the Close button on the Form Filter toolbar, the form is displayed without a filter." msgstr "Dersom du trykkjer på Lukk-knappen på verktøylinja for skjemafilter, vert skjemaet vist utan filter." #: data_search2.xhp msgctxt "" "data_search2.xhp\n" "par_id3150114\n" "11\n" "help.text" msgid "Click the Apply Filter icon Icon on the Form Navigation toolbar to change to the filtered view." msgstr "Klikk på symbolet Legg til filter Ikon på verktøylinja Skjemastruktur for å byta til filtrert vising." #: data_search2.xhp msgctxt "" "data_search2.xhp\n" "par_id3146898\n" "12\n" "help.text" msgid "The filter that has been set can be removed by clicking Reset Filter/Sort icon Icon." msgstr "Filteret som er sett opp kan fjernast ved å klikka på symbolet Nullstill filter/sortering Ikon." #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "tit\n" "help.text" msgid "Table Design" msgstr "Tabellutforming" #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "bm_id3155448\n" "help.text" msgid "tables in databases; creating in design view (manually) designing; database tables properties;fields in databases fields;database tables AutoValue (Base) primary keys;design view" msgstr "tabellar i databasar; laga i utformingsvising (manuelt)utforma; databasetabellareigenskapar;felt i databasarfelt;databasetabellarAutoverdi (Base)primærnøklar;utformingsvising" #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "hd_id3149798\n" "104\n" "help.text" msgid "Table Design" msgstr "Tabellutforming" #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "par_id3155535\n" "2\n" "help.text" msgid "This section contains information about how to create a new database table in the design view." msgstr "Dette avsnittet inneheld informasjon om korleis du lagar ein ny databasetabell i utformingsvising." #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "par_id3154288\n" "3\n" "help.text" msgid "Open the database file of the database where you want a new table. Click the Tables icon. Choose Create Table in Design View to create a new table." msgstr "Opna databasefila som du vil laga ein ny tabell i. Klikk på ikonet Tabellar. Vel Lag tabell i utformingsvising for å laga ein ny tabell." #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "par_id3146798\n" "4\n" "help.text" msgid "In the Design view, you can now create the fields for your table." msgstr "Du kan nå laga felt for tabellen i utformingsvisinga." #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "par_id3153349\n" "5\n" "help.text" msgid "Enter new fields in rows from top to bottom. Click the Field Name cell and enter a field name for each data field." msgstr "Skriv inn nye felt i rader ovanfrå og nedover. Klikk på cella Feltnamn og skriv inn eit feltnamn for kvart datafelt." #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "par_id1595507\n" "help.text" msgid "Include a \"primary key\" data field. Base needs a primary key to be able to edit the table contents. A primary key has unique contents for each data record. For example, insert a numerical field, right-click the first column, and choose Primary Key from the context menu. Set AutoValue to \"Yes\", so Base can automatically increment the value for each new record." msgstr "Inkluder eit datafelt for «primærnøkkel». Base krev ein primærnøkkel for å kunna redigera innhaldet i tabellen. Ein primærnøkkel har unikt innhald for kvar datapost. For eksempel, sett inn eit numerisk felt, høgreklik på den første kolonnen og vel Primærnøkkel frå sprettoppmenyen. Set Automatisk verdi til «Ja» så Base automatisk aukar verdien for kvar ny datapost." #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "par_id3150084\n" "6\n" "help.text" msgid "In the next cell to the right, define the Field Type. When you click in the cell, you can select a field type in the combo box." msgstr "Vel Felttype i neste celle til høgre. Når du klikkar i cella, kan du velja ein felttype i kombinasjonsboksen." #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "par_id3154760\n" "38\n" "help.text" msgid "Each field can only accept data corresponding to the specified field type. For example, it is not possible to enter text in a number field. Memo fields in dBASE III format are references to internally-managed text files which can hold up to 64KB text." msgstr "Kvart felt kan berre ha data som svarar til den angjevne felttypen. For eksempel er det ikkje mogleg å skriva inn tekst i eit talfelt. Memofelt i dBASE III-format er tilvisingar til internt administrerte tekstfiler som kan innehalda opp til 64 KB tekst." #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "par_id3149456\n" "41\n" "help.text" msgid "You can enter an optional Description for each field. The text of the description will appear as a tip on the column headings in the table view." msgstr "Du kan skriva inn ei valfri Skildring for kvart felt. Teksten for forklaringa vert vist som eit tips på kolonneoverskriftene i tabellvisinga." #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "hd_id3153379\n" "42\n" "help.text" msgid "Field Properties" msgstr "Felteigenskapar" #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "par_id3148798\n" "45\n" "help.text" msgid "Enter properties for each selected data field. Depending on the database type, some input facilities may not be available." msgstr "Skriv inn eigenskapar for kvart merkt datafelt. Kva for eigenskapar som er tilgjengelege, er avhengig av databasetypen." #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "par_id3144762\n" "46\n" "help.text" msgid "In the Default value box, enter the default contents for every new record. This contents can be edited later." msgstr "Skriv inn standardinnhald for kvar ny datapost i feltet Standardverdi. Innhaldet kan endrast seinare om nødvendig." #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "par_id3150869\n" "47\n" "help.text" msgid "In the Entry required box, specify whether or not the field may remain empty." msgstr "Bestem om feltet kan vera tomt i boksen Oppføring påkravd." #: data_tabledefine.xhp msgctxt "" "data_tabledefine.xhp\n" "par_id3154908\n" "7\n" "help.text" msgid "For the Length box, a combo box may be shown that provides the available choices." msgstr "For feltet Lengd kan ein kombinasjonsboks med dei tilgjengelege vala koma fram." #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "tit\n" "help.text" msgid "Working with Tables" msgstr "Arbeida med tabellar" #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "bm_id1983703\n" "help.text" msgid "tables in databases;creatingdatabases;creating tablestable views of databases" msgstr "tabellar i databasar;lagadatabasar;laga tabellartabellvisingar av databasar" #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN105F9\n" "help.text" msgid "Working with Tables" msgstr "Arbeida med tabellar" #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN10617\n" "help.text" msgid "Data is stored in tables. As an example, your system address book that you use for your e-mail addresses is a table of the address book database. Each address is a data record, presented as a row in that table. The data records consist of data fields, for example the first and the last name fields and the e-mail field." msgstr "Data vert lagra i tabellar. For eksempel er systemadresseboka di, som du brukar til e-post-adresser, ein tabell i adresseboksdatabasen. Kvar adresse er ein datapost, presentert som ei rekkje i tabellen. Datapostane består av datafelt, for eksempel felta fornamn, etternamn og e-post." #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN1061A\n" "help.text" msgid "Creating a New Table With the Table Wizard" msgstr "Slik lagar du ein ny tabell med vegvisaren" #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN1061E\n" "help.text" msgid "In %PRODUCTNAME you can create a new table using the Table Wizard:" msgstr "I %PRODUCTNAME kan du laga ein ny tabell ved å bruka tabellvegvisaren:" #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN10632\n" "help.text" msgid "Open the database file where you want to create the new table." msgstr "Opna databasefila som du vil laga den nye tabellen i." #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN10636\n" "help.text" msgid "In the left pane of the database window, click the Tables icon." msgstr "Trykk på ikonet Tabellar i det venstre feltet i databasevindauget." #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN1063E\n" "help.text" msgid "Click Use Wizard to Create Table." msgstr "Trykk på Lag tabell med vegvisar." #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN10645\n" "help.text" msgid "Creating a New Table With the Design View" msgstr "Slik lager du ein ny tabell med utformingsvising" #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN1064C\n" "help.text" msgid "Open the database file where you want to create the new table." msgstr "Opna databasefila som du vil laga den nye tabellen i. " #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN10650\n" "help.text" msgid "In the left pane of the database window, click the Tables icon." msgstr "Trykk på ikonet Tabellar i det venstre feltet i databasevindauget." #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN10658\n" "help.text" msgid "Click Create Table in Design View." msgstr "Trykk på Lag tabell i utformingsvising." #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN1065F\n" "help.text" msgid "You see the Table Design window." msgstr "Vindauget Tabellutforming vert opna." #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN10778\n" "help.text" msgid "Creating a New Table View" msgstr "Laga ei ny tabellutforming" #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN1077C\n" "help.text" msgid "Some database types support table views. A table view is a query that is stored with the database. For most database operations, a view can be used as you would use a table." msgstr "Nokre databasetypar har støtte for tabellvisingar. Ei tabellvising er ei spørjing som vert lagra med databasen. For dei fleste databaseoperasjonane kan ei visning brukast på same måten som ein tabell." #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN10782\n" "help.text" msgid "Open the database file where you want to create the new table view." msgstr "Opna databasefila som du vil laga den nye tabellvisinga i." #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN10786\n" "help.text" msgid "In the left pane of the database window, click the Tables icon." msgstr "Trykk på ikonet Tabellar i det venstre feltet i databasevindauget." #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN1078E\n" "help.text" msgid "Click Create Table View." msgstr "Trykk på Lag tabellvising." #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN10795\n" "help.text" msgid "You see the View Design window, which is almost the same as the Query Design window." msgstr "Dette opnar vindauget Visingsutforming. Dette vindauget er nesten det same som vindauget for spørjingsutforming." #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN1067B\n" "help.text" msgid "" msgstr "" #: data_tables.xhp msgctxt "" "data_tables.xhp\n" "par_idN10683\n" "help.text" msgid "" msgstr "" #: data_view.xhp msgctxt "" "data_view.xhp\n" "tit\n" "help.text" msgid "Viewing a Database" msgstr "Vise ein database" #: data_view.xhp msgctxt "" "data_view.xhp\n" "bm_id2339854\n" "help.text" msgid "opening;database filesviewing; databasesdata sources;viewingdatabases;viewing" msgstr "opna;databasefilervisa; databasardatakjelder;visadatabasar;visa" #: data_view.xhp msgctxt "" "data_view.xhp\n" "par_idN105A6\n" "help.text" msgid "Viewing a Database" msgstr "Visa ein database" #: data_view.xhp msgctxt "" "data_view.xhp\n" "par_idN105C4\n" "help.text" msgid "There are two different methods of viewing a database in %PRODUCTNAME." msgstr "I %PRODUCTNAME kan ein database visast på to ulike måtar." #: data_view.xhp msgctxt "" "data_view.xhp\n" "par_idN105CA\n" "help.text" msgid "Choose File - Open to open the database file." msgstr "Vel Fil → Opna for å opna databasefila." #: data_view.xhp msgctxt "" "data_view.xhp\n" "par_idN105D1\n" "help.text" msgid "The database file gives you full access to tables, queries, reports, and forms. You can edit the structure of your tables and change the contents of the data records." msgstr "Databasefil gir deg full tilgang til tabellar, spørjingar, rapportar og skjema. Du kan redigera tabellstrukturane dine og byta ut innhaldet i datapostane." #: data_view.xhp msgctxt "" "data_view.xhp\n" "par_idN105E3\n" "help.text" msgid "Choose View - Data source to view the registered databases." msgstr "Vel Vis → Datakjelde for å sjå dei registrerte databasane." #: data_view.xhp msgctxt "" "data_view.xhp\n" "par_idN105EA\n" "help.text" msgid "The data source view can be used to drag-and-drop table fields from registered databases into your documents and to produce mail merges." msgstr "Datakjeldevising kan brukast for å dra og sleppa tabellfelt frå registrerte databasar i dokument, og for å laga e-postfletting." #: data_view.xhp msgctxt "" "data_view.xhp\n" "par_idN10606\n" "help.text" msgid "" msgstr "" #: data_view.xhp msgctxt "" "data_view.xhp\n" "par_idN1060E\n" "help.text" msgid "" msgstr "" #: database_main.xhp msgctxt "" "database_main.xhp\n" "tit\n" "help.text" msgid "Database Overview" msgstr "Databaseoversikt" #: database_main.xhp msgctxt "" "database_main.xhp\n" "bm_id3153031\n" "help.text" msgid "databases; overviewdata source view; overviewdata source explorerexplorer of data sources" msgstr "databasar; oversiktdatakjeldevising; oversiktdatakjeldeutforskarutforskar for datakjelder" #: database_main.xhp msgctxt "" "database_main.xhp\n" "hd_id3148474\n" "2\n" "help.text" msgid "Database Overview" msgstr "Databaseoversikt" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_idN105F1\n" "help.text" msgid "Working with databases in %PRODUCTNAME" msgstr "Arbeida med databasar i %PRODUCTNAME" #: database_main.xhp msgctxt "" "database_main.xhp\n" "hd_id3153821\n" "3\n" "help.text" msgid "Data Source View" msgstr "Datakjeldevising" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_id3149415\n" "4\n" "help.text" msgid "Choose View - Data Sources or press F4 to call the data source view from a text document or spreadsheet." msgstr "Vel Vis → Datakjelder eller trykk på F4 for å henta inn datajeildevisinga frå eit tekstdokument eller eit rekneark." #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_id3147531\n" "5\n" "help.text" msgid "On the left you can see the Data source explorer. If you select a table or query there, you see the contents of this table or query on the right. At the top margin is the Table Data bar." msgstr "På venstre side kan du sjå datakjeldeutforskaren. Viss du merker ein tabell eller ei spørjing, ser du innhaldet i denne tabellen eller spørjinga til høgre. Ved den øvste kanten er verktøylinja Tabelldata." #: database_main.xhp msgctxt "" "database_main.xhp\n" "hd_id3149047\n" "6\n" "help.text" msgid "Data Sources" msgstr "Datakjelder" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_id3145069\n" "7\n" "help.text" msgid "Address book as data source" msgstr "Adressebok som datakjelde" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_id3150398\n" "9\n" "help.text" msgid "View data source contents" msgstr "Vis datakjeldeinnhaldet" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_idN106A4\n" "help.text" msgid "Menu bar of a database file" msgstr "Menylinje for ei databasefil" #: database_main.xhp msgctxt "" "database_main.xhp\n" "hd_id3154123\n" "16\n" "help.text" msgid "Forms and Reports" msgstr "Skjema og rapportar" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_id3154909\n" "17\n" "help.text" msgid "Create new form document, edit form controls, Form Wizard" msgstr "Lag eit nytt skjemadokument, rediger kontrollelement for skjema, Skjemavegvisar" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_id3152920\n" "18\n" "help.text" msgid "Entering data versus editing form" msgstr "Skriva inn data i høve til å redigera skjema" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_id3151380\n" "23\n" "help.text" msgid "Report Wizard" msgstr "Rapportvegvisar" #: database_main.xhp msgctxt "" "database_main.xhp\n" "hd_id3145606\n" "13\n" "help.text" msgid "Queries" msgstr "Spørjingar" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_id3125864\n" "14\n" "help.text" msgid "Create new query or table view, edit query structure" msgstr "Laga ny spørjing eller tabellvising, redigera spørjingsstruktur" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_idN1072A\n" "help.text" msgid "Query Wizard" msgstr "Spørjingsvegvisar" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_id3155430\n" "15\n" "help.text" msgid "Enter, edit and copy records" msgstr "Skriva inn, redigera og kopiera postar" #: database_main.xhp msgctxt "" "database_main.xhp\n" "hd_id3147287\n" "10\n" "help.text" msgid "Tables" msgstr "Tabellar" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_id3163713\n" "11\n" "help.text" msgid "Create new table, edit table structure, index, relations" msgstr "Laga ny tabell, redigera tabellstruktur, indeks, relasjonar" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_idN1078F\n" "help.text" msgid "Table Wizard" msgstr "Tabellvegvisar" #: database_main.xhp msgctxt "" "database_main.xhp\n" "par_id3159196\n" "12\n" "help.text" msgid "Enter, edit and copy records" msgstr "Skriva inn, redigera og kopiera postar" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "tit\n" "help.text" msgid "About Digital Signatures" msgstr "Om digitale signaturar" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "bm_id7430951\n" "help.text" msgid "certificates digital signatures;overview security;digital signatures" msgstr "sertifikatdigitale signaturar;oversikttryggleik;digitale signaturar" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "hd_id2767418\n" "help.text" msgid "About Digital Signatures" msgstr "Om digitale signaturar " #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_idN10632\n" "help.text" msgid "In %PRODUCTNAME, you can digitally sign your documents and macros." msgstr "I %PRODUCTNAME kan du signera dokumenta og makroane dine digitalt." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "hd_id6564531\n" "help.text" msgid "Certificates" msgstr "Sertifikat" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_idN10639\n" "help.text" msgid "To sign a document digitally, you need a personal key, the certificate. A personal key is stored on your computer as a combination of a private key, which must be kept secret, and a public key, which you add to your documents when you sign them." msgstr "For å signera eit dokument digitalt treng du ein personleg nøkkel. Den personlege nøkkelen vert lagra på datamaskinen som ein kombinasjon av ein privat nøkkel, som skal haldast hemmeleg, og ein offentleg nøkkel som du legg til dokumenta dine når du signerer dei." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_idN1066D\n" "help.text" msgid "Save and sign the document" msgstr "Lagra og signera dokumentet" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_idN10671\n" "help.text" msgid "When you apply a digital signature to a document, a kind of checksum is computed from the document's content plus your personal key. The checksum and your public key are stored together with the document." msgstr "Når du legg ein digital signatur til eit dokument, vert det rekna ut ei form for sjekksum basert på innhaldet i dokumentet og den personlege nøkkelen din. Sjekksummen og den offentlege nøkkelen din vert lagra saman med dokumentet." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_idN10674\n" "help.text" msgid "Open a signed document" msgstr "Opna eit signert dokument" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_idN10678\n" "help.text" msgid "When someone later opens the document on any computer with a recent version of %PRODUCTNAME, the program will compute the checksum again and compare it with the stored checksum. If both are the same, the program will signal that you see the original, unchanged document. In addition, the program can show you the public key information from the certificate." msgstr "Når andre seinare opnar dokumentet på ein datamaskin med ein nyare versjon av %PRODUCTNAME, vil programmet rekna ut sjekksummen igjen og samanlikne denne med den lagra summen. Viss begge stemmer, vil programmet gje melding om at du ser det originale, uendra dokumentet. I tillegg kan programmet visa deg den offentlege nøkkelinformasjonen frå sertifikatet." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_idN1067B\n" "help.text" msgid "You can compare the public key with the public key that is published on the web site of the certificate authority." msgstr "Du kan samanlikna den offentlige nøkkelen med den som finst på sertifikatutgjevaren si heimeside." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_idN1067E\n" "help.text" msgid "Whenever someone changes something in the document, this change breaks the digital signature. After the change, there will be no sign that you see the original document." msgstr "Når nokon endrar dokumentet vert den digitale signaturen øydelagt. Etter endringa vil det ikkje vera noko form for varsel om at det er det opphavlege dokumentet som vert vis." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id2008200911381426\n" "help.text" msgid "The result of the signature validation is displayed in the status bar and within the Digital Signature dialog. Several documents and macro signatures can exist inside an ODF document. If there is a problem with one signature, then the validation result of that one signature is assumed for all signatures. That is, if there are ten valid signatures and one invalid signature, then the status bar and the status field in the dialog will flag the signature as invalid." msgstr "Resultatet av signaturvalideringa vert vist i statuslinja og i dialogvindauget for digital signatur. Eit ODF-dokument kan innehalda fleire dokument- og makrosignaturar. Om éin av signaturane ikkje vert godkjend, vil ingen av signaturane verta godkjende. Dette betyr at dersom eit dokument inneheld ti gyldige signaturar og éin ugyldig signatur, vil statuslinja og statusfeltet i dialogvindauget visa at signaturane er ugyldige." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id0821200911571878\n" "help.text" msgid "You can see any of the following icons and messages when you open a signed document." msgstr "Ikon og meldingar som kan verta viste når du opnar eit signert dokument." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id0821200912504050\n" "help.text" msgid "Icon in Status bar" msgstr "Ikon på statuslinja" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id0821200912504061\n" "help.text" msgid "Signature status" msgstr "Signaturstatus" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id0821200912504010\n" "help.text" msgid "Icon" msgstr "Ikon" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id0821200912504189\n" "help.text" msgid "The signature is valid." msgstr "Signaturen er gyldig." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id082120091250418\n" "help.text" msgid "Icon" msgstr "Ikon" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id0821200912504133\n" "help.text" msgid "The signature is OK, but the certificates could not be validated." msgstr "Signaturen er i orden, men det var uråd å kontrollera sertifikatet." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id0821200912504165\n" "help.text" msgid "The signature and the certificate are OK, but not all parts of the document are signed. (For documents that were signed with old versions of the software, see note below.)" msgstr "Signaturen og sertifikatet er i orden, men ikkje alle delane av dokumentet er signert. (For dokument som er signert med eldre versjonar av programmet, sjå merknaden nedanfor)." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id0821200912504237\n" "help.text" msgid "Icon" msgstr "Ikon" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id0821200912504233\n" "help.text" msgid "The signature is invalid." msgstr "Signaturen er ikkje gyldig." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "hd_id0821200910191787\n" "help.text" msgid "Signatures and software versions" msgstr "Signaturar og programvareversjonar" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id0821200910191747\n" "help.text" msgid "The signing of contents got changed with OpenOffice.org 3.2 and StarOffice 9.2. Now all contents of the files, except the signature file itself (META-INF/documentsignatures.xml) are signed." msgstr "Signeringa av innhaldet vart endra frå og med OpenOffice.org 3.2 og StarOffice 9.2. Nå vert alt innhaldet i filene signert, unntatt signaturfila (META-INF/documentsignatures.xml)." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id0821200910191774\n" "help.text" msgid "When you sign a document with OpenOffice.org 3.2 or StarOffice 9.2 or a later version, and you open that document in an older version of the software, the signature will be displayed as \"invalid\". Signatures created with older versions of the software will be marked with \"only parts of the documents are signed\" when loaded in the newer software." msgstr "Når du signerer eit dokument med OpenOffice.org 3.2 eller StarOffice 9.2 og seinare versjonar og deretter opnar dokumentet i ein tidlegare versjon, vert signaturen vist som «ugyldig». Signaturar som er laga med tidlegare versjonar vert merkte med «berre delar av dokumentet er signert» når det vert lasta inn i nyare program." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id2008200911583098\n" "help.text" msgid "When you load an ODF document, you might see an icon in the status bar and the status field in the dialog that indicates that the document is only partially signed. This status will appear when the signature and certificate are valid, but they were created with a version of OpenOffice.org before 3.2 or StarOffice before 9.2. In versions of OpenOffice.org before 3.0 or StarOffice before 9.0, the document signature was applied to the main contents, pictures and embedded objects only and some contents, like macros, were not signed. In OpenOffice.org 3.0 and StarOffice 9.0 the document signature was applied to most content, including macros. However, the mimetype and the content of the META-INF folder were not signed. And in OpenOffice.org 3.2, StarOffice 9.2, and all versions of LibreOffice all contents, except the signature file itself (META-INF/documentsignatures.xml), are signed." msgstr "Når du opnar eit ODF-dokument kan det henda du ser eit symbol i statuslinja og statusfeltet som visar at dokumentet er berre delvis signert. Denne statusen vert vist når signaturen og sertifikatet er gyldig men er laga med ein versjon av OpenOffice eldre enn 3.2 eller StarOffice eldre enn 9,2. I desse tidlegare versjonane vart dokumentsignaturen lagt berre til hovudinnhaldet, bilete og innebygde objekt medan andre delar av innhaldet, som makroar, ikkje vart signerte. I OpenOffice.org 3.0 og StarOffice 9.0 vart signaturen lagt til det meste av innhaldet, også makroar, men mimetypen og innhaldet i mappa META-INF vart likevel ikkje signert. I OpenOffice.org 3.2 og StarOffice 9.2 og alle versjonar av LibreOffice vert alt innhaldet unntatt signaturfila (META-INF/documentsignatures.xml) signert." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "hd_id9354228\n" "help.text" msgid "Security Warnings" msgstr "Tryggleiksåtvaringar" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id2372508\n" "help.text" msgid "When you receive a signed document, and the software reports that the signature is valid, this does not mean that you can be absolutely sure that the document is the same that the sender has sent. Signing documents with software certificates is not a perfectly secure method. Numerous ways are possible to circumvent the security features." msgstr "Når du mottar eit signert dokument og programmet melder at signaturen er gyldig, betyr dette ikkje det at du kan vera heilt sikker på at dokumentet er det same som det avsendaren sende. Signering av dokumenter med sertifikat er ikkje ein heilt sikker metode. Der er fleire måtar å omgå tryggingssystemet på." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id7953123\n" "help.text" msgid "Example: Think about someone who wants to camouflage his identity to be a sender from your bank. He can easily get a certificate using a false name, then send you any signed e-mail pretending he is working for your bank. You will get that e-mail, and the e-mail or the document within has the \"valid signed\" icon." msgstr "Eksempel: Tenk deg at nokon ønskjer å utgi seg for å vera banken din. Dei kan enkelt få eit sertifikat ved å bruka falskt namn og senda deg ein signert e-post der dei oppgjev å arbeida for banken din. Du vil motta e-posten og posten eller dokumentet vil ha symbolet for «gyldig signatur»." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id6195257\n" "help.text" msgid "Do not trust the icon. Inspect and verify the certificates." msgstr "Ikkje stol på ikonet. Undersøk og godkjenn sertifikata." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id8635517\n" "help.text" msgid "The validation of a signature is not a legally binding guarantee of any kind." msgstr "Godkjenninga av ein digital signatur er på ingen måte ein juridisk bindande garanti." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id6075624\n" "help.text" msgid "On Windows operating systems, the Windows features of validating a signature are used. On Solaris and Linux systems, files that are supplied by Thunderbird, Mozilla or Firefox are used. You must ensure that the files that are in use within your system are really the original files that were supplied by the original developers. For malevolent intruders, there are numerous ways to replace original files with other files that they supply." msgstr "På Windows-datamaskiner vert den innebygde godkjenninga av signaturar brukt. På Solaris og Linux vert filer frå Thunderbird, Mozilla eller Firefox brukte. Du må forsikra deg om at tryggleikfilene som finst på datamaskinen er dei same som kjem frå dei opphavlege utviklarane. Uærlege personar har mange metodar for å byta ut tryggleiksfilene med eigne versjonar." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id6819971\n" "help.text" msgid "The messages about validation of a signature that you see in %PRODUCTNAME are the messages that the validation files return. The %PRODUCTNAME software has no way to ensure that the messages reflect the true status of any certificate. The %PRODUCTNAME software only displays the messages that other files that are not under control of %PRODUCTNAME report. There is no legal responsibility of %PRODUCTNAME that the displayed messages reflect the true status of a digital signature." msgstr "Meldingane om godkjenning av ein signatur som vert vist i %PRODUCTNAME stammer frå godkjenningssfilene. %PRODUCTNAME kan på ingen måte vera sikker på at meldingane viser rett status for eit sertifikat. %PRODUCTNAME viser berre meldingar frå andre filer som er utanfor %PRODUCTNAME sin kontroll. Det finst ingen juridisk ansvar for at %PRODUCTNAME viser meldingar som samsvarar med den korrekte statusen for ein digital signatur." #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id3204443\n" "help.text" msgid "English Wiki page on digital signatures" msgstr "Engelsk Wikiside om digitale signaturar" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id486465\n" "help.text" msgid "Applying digital signatures" msgstr "Leggja til digitale signaturar" #: digital_signatures.xhp msgctxt "" "digital_signatures.xhp\n" "par_id3448591\n" "help.text" msgid "Opening a document using WebDAV over HTTPS" msgstr "Opna eit dokument ved bruk av WebDAV over HTTPS" #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "tit\n" "help.text" msgid "Opening a Document Using WebDAV over HTTPS" msgstr "Opna eit dokument ved bruk av WebDAV over HTTPS" #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "bm_id7430951\n" "help.text" msgid "opening;documents on WebDAV serverWebDAV over HTTPSdigital signatures;WebDAV over HTTPS" msgstr "opna;dokument på WebDAV-tenarWebDAV over HTTPSdigitale signaturar;WebDAV over HTTPS" #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "hd_id4989165\n" "help.text" msgid "Opening a Document Using WebDAV over HTTPS " msgstr "Opna eit dokument ved bruk av WebDAV over HTTPS " #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id1399578\n" "help.text" msgid "In %PRODUCTNAME, you can open and save documents that are stored on a WebDAV server, using the secure HTTPS protocol." msgstr "I %PRODUCTNAME kan du opna og lagra dokument som er plassert på ein WebDAV-tenar ved å bruka den sikre HTTPS-protokollen." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id598162\n" "help.text" msgid "You must use the %PRODUCTNAME file dialogs to use WebDAV over HTTPS." msgstr "Du må bruka %PRODUCTNAME-fildialogen for å bruka WebDAV over HTTPS." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id7309793\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME - General. Ensure that Use %PRODUCTNAME dialogs is enabled. Click OK to close the dialog box." msgstr "Vel %PRODUCTNAME → InnstillingarVerktøy → Innstillingar%PRODUCTNAME → Generelt. Sjå etter at det er merka av for Bruk dialogvindauga til %PRODUCTNAME. Tykk OK for å lukka vindauget." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id1227759\n" "help.text" msgid "Choose File - Open." msgstr "Vel Fil → Opna." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id7424237\n" "help.text" msgid "In the File name box, enter the path to the WebDAV folder. For example, enter https://192.168.1.1/webfolder to open a secure connection to the WebDAV server at the IP address 192.168.1.1, and to list the contents of the webfolder folder." msgstr "Skriv inn stien til WebDAV-mappa i boksen Filnamn. Skriv for eksempel https://192.168.1.1/vevmappe for å opna ei sikker kopling til WebDAV-tenaren på IP-adressa 192.168.1.1 og for å visa innhaldet i vevmappe." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id1388592\n" "help.text" msgid "The first time you connect to a WebDAV server, you see the \"Website Certified by an Unknown Authority\" dialog." msgstr "Første gongen du koplar deg til ein WebDAV-tenar ser du dialogvindauget«Nettstaden er sertifisert av ein ukjend utskrivar»." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id343943\n" "help.text" msgid "You should click the Examine Certificate button and examine the certificate." msgstr "Du bør klikke på knappen Undersøk sertifikat og kontrollera sertifikatet." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id8726767\n" "help.text" msgid "If you accept the certificate, choose \"Accept this certificate temporarily for this session\" and click OK. Now you can open and save files from the WebDAV server without further questions, until you exit %PRODUCTNAME." msgstr "Viss du godkjenner sertifikatet, vel «Godta dette sertifikatet mellombels for denne økta» og klikk OK. Nå kan du opna og lagre filer frå WebDAV-tenaren utan fleire spørsmål, til du avsluttar %PRODUCTNAME." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id691549\n" "help.text" msgid "If you do not trust the certificate, click Cancel." msgstr "Viss du ikkje stolar på sertifikatet, klikk på Avbryt." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id9909665\n" "help.text" msgid "If you did accept the certificate, you can now select the file name or file names you want to open and click Open." msgstr "Viss du godtar sertifikatet, kan du merkja filnamnet eller filnamna du vil opna og klikka på Opna." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id3236182\n" "help.text" msgid "If there is a mismatch of the domain name given in the certificate and the domain name you entered in the file dialog, then you see a dialog that allows you to choose from any of the following options:" msgstr "Viss det ikkje er samsvar mellom domenenamnet i sertifikatet og det domenenamnet du skreiv inn, vil det koma opp eit dialogvindauge der du kan velja éin av desse:" #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id1251258\n" "help.text" msgid "View Certificate - Opens the View Certificate dialog." msgstr "Vis sertifikat - Opnar dialogvindauget «Vis sertifikat»." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id8111819\n" "help.text" msgid "Continue - If you are sure both domains are the same, click the Continue button." msgstr "Hald fram - Viss du er sikker på at begge domena er identiske, klikk på «Hald fram»." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id9116794\n" "help.text" msgid "Cancel Connection - Cancels the connection." msgstr "Avbryt tilkoplinga - Avbryt tilkoplinga." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id4381847\n" "help.text" msgid "If you click Continue, you may see a dialog that asks you to enter your user name and password." msgstr "Viss du klikkar Hald fram, kan det henda at det kjem fram eit dialogvindauge som bed deg om å skriva inn brukarnamnet og passordet ditt." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id1336710\n" "help.text" msgid "Enter your user name to log on to the WebDAV server." msgstr "Skriv inn brukarnamnet for å logga på WebDAV-tenaren." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id1221655\n" "help.text" msgid "Enter your password." msgstr "Skriv inn passordet." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id3397320\n" "help.text" msgid "If you enable Remember password till end of session, your password will be remembered for subsequent WebDAV connections until you exit %PRODUCTNAME." msgstr "Viss du slår på Hugs passord til slutten av økta, vert passordet ditt hugsa for etterfølgjande WebDAV-tilkoplingar til du avsluttar %PRODUCTNAME." #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id3204443\n" "help.text" msgid "English Wiki page on digital signatures" msgstr "Engelsk wikiside om digitale signaturar" #: digitalsign_receive.xhp msgctxt "" "digitalsign_receive.xhp\n" "par_id2182378\n" "help.text" msgid "About digital signatures" msgstr "Om digitale signaturar" #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "tit\n" "help.text" msgid "Applying Digital Signatures" msgstr "Leggja til digitale signaturar" #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "bm_id7430951\n" "help.text" msgid "signing documents with digital signatures digital signatures;getting/managing/applying" msgstr "skriva under dokument med digitale signaturar digitale signaturar;skaffa/handtera/bruka" #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "hd_id344248\n" "help.text" msgid "Applying Digital Signatures" msgstr "Bruka digitale signaturar" #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN1063C\n" "help.text" msgid "Getting a Certificate" msgstr "Skaffa eit sertifikat" #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN10640\n" "help.text" msgid "You can get a certificate from a certification authority. No matter if you choose a governmental institution or a private company it is common to be charged for this service, for example when they certify your identity. Few other authorities issue certificates free of costs, like the Open Source Project CAcert which is based on the well-known and reliable Web of Trust model and is of growing popularity." msgstr "Du kan skaffa deg eit sertifikat frå ein sertifikatutskrivar. Om du vel ein offentleg institusjon eller eit privat firma, er det vanleg å måtte betala for sertifikatet for eksempel når dei bekreftar identiteten din. Det er også råd å få gratis sertifikat for eksempel frå CAcert, som er eit «Open Source Project» basert på den stadig meir populære og pålitelege modellen «Web of Trust»." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN106F6\n" "help.text" msgid "Managing your Certificates" msgstr "Handtera sertifikata dine" #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN1070A\n" "help.text" msgid "If you are using Microsoft Windows, you can manage your certificates from the Control Panel applet \"Internet Options\" on the \"Contents\" tab page." msgstr "Viss du brukar Microsoft Windows, kan du handtera sertifikata dine frå kontrollpanelet under «Internettinnstillinger » (vel fana «Innhold») (Microsoft har ikkje nynorsk).." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_id8311410\n" "help.text" msgid "Import your new root certificate into the Trusted Root Certification Authorities list." msgstr "Importer det nye rotsertifikatet ditt til lista over «Trusted Root Certification Authorities»." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN1071D\n" "help.text" msgid "If you are using Solaris or Linux, you must install a recent version of Thunderbird, Mozilla Suite, or Firefox software to install some system files that are needed for encryption." msgstr "Viss du brukar Solaris eller Linux, må du installera ein av de nyaste versjonane av Thunderbird, Mozilla Suite eller Firefox for å installera systemfiler som er nødvendige for krypteringa." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN10720\n" "help.text" msgid "If you have created different profiles in Thunderbird, Mozilla, or Firefox, and you want %PRODUCTNAME to use one specified profile for certificates, then you can set the environment variable MOZILLA_CERTIFICATE_FOLDER to point to the folder of that specified profile." msgstr "Viss du har laga ulike profilar i Thunderbird, Mozilla eller Firefox og du ønskjer at %PRODUCTNAME skal bruka ein av dei til sertifikat, så kan du setja miljøvariabelen MOZILLA_CERTIFICATE_FOLDER til å peika på mappa med den ønskte profilen." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_id944242\n" "help.text" msgid "Open your Web browser's preferences dialog, select the Privacy & Security tab page, click on Certificates - Manage Certificates." msgstr "Opna dialogvindauget for innstillingar i nettlesaren din og vel «Privatliv og tryggleik og, klikk på «Sertifikat → Administrer sertifikat»." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_id6452223\n" "help.text" msgid "Import your new root certificate, then select and edit the certificate. Enable the root certificate to be trusted at least for web and email access. This ensures that the certificate can sign your documents. You may edit any intermediate certificate in the same way, but it is not mandatory for signing documents." msgstr "Importer det nye rotsertifikatet ditt. Merk sertifikatet og rediger det. Aktiver rotsertifikatet til å vera tiltrudd for nett- og e-post-tilgang. Dette sikrar at sertifikatet kan signera dokumenta dine. Du kan redigere kva mellomsertifikat som helst på same måten, men dette er ikkje eit krav for å signera dokument." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_id6486098\n" "help.text" msgid "When you have edited the new certificates, restart %PRODUCTNAME." msgstr "Start %PRODUCTNAME på nytt når du har redigert dei nye sertifikata." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN10681\n" "help.text" msgid "Signing a document" msgstr "Signera eit dokument" #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN10688\n" "help.text" msgid "Choose File - Digital Signatures." msgstr "Vel Fil → Digitale signaturar" #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN10690\n" "help.text" msgid "A message box advises you to save the document. Click Yes to save the file." msgstr "Ein meldingsboks rår deg til å lagra dokumentet. Trykk Ja for å lagra dokumentet." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN10698\n" "help.text" msgid "After saving, you see the Digital Signatures dialog. Click Add to add a public key to the document." msgstr "Når du har lagra dokumentet vert dialogvindauget Digitale signaturar opna. Trykk på Legg til for å leggja til ein offentleg nøkkel i dokumentet." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN106AE\n" "help.text" msgid "In the Select Certificate dialog, select your certificate and click OK." msgstr "Merk sertifikatet ditt i dialogvindauget Vel sertifikat og trykk på «OK»." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN106C0\n" "help.text" msgid "You see again the Digital Signatures dialog, where you can add more certificates if you want. Click OK to add the public key to the saved file." msgstr "Dialogvindauget for digitale signaturar vert opna igjen. Her kan du leggja til fleire sertifikat om du ønskjer det. Klikk «OK» for å leggja den offentlege nøkkelen til den lagra fila." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN106C3\n" "help.text" msgid "A signed document shows an icon Icon in the status bar. You can double-click the icon in the status bar to view the certificate." msgstr "Eit signert dokument viser ikonet Ikon i statuslinja. Du kan dobbeltklikka på dette for å sjå sertifikatet." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_id2008200911381426\n" "help.text" msgid "The result of the signature validation is displayed in the status bar and within the Digital Signature dialog. Several documents and macro signatures can exist inside an ODF document. If there is a problem with one signature, then the validation result of that one signature is assumed for all signatures. That is, if there are ten valid signatures and one invalid signature, then the status bar and the status field in the dialog will flag the signature as invalid." msgstr "Resultatet av signaturvalideringa vert vist i statuslinja og i dialogvindauget for digitale signaturar. Det kan vera mange dokument- og makrosignaturar i eit ODF-dokument. Dersom éin av signaturane ikkje vert godkjend, vil ingen av signaturane verta godkjende. Dette betyr at dersom det er ti gyldige signaturar og ein ugyldig signatur, vil statuslinja og statusfeltet visa at signaturen er ugyldig." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN106E0\n" "help.text" msgid "Signing the macros inside a document" msgstr "Signering av makroane i eit dokument" #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN106E4\n" "help.text" msgid "Normally, macros are part of a document. If you sign a document, the macros inside the document are signed automatically. If you want to sign only the macros, but not the document, proceed as follows:" msgstr "Normalt er makroar er del av eit dokument. Viss du signerer eit dokument, vert makroane i dokumentet automatisk signerte. Viss du vil berre signera makroane og ikkje dokumentet, gjer du slik:" #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN106EA\n" "help.text" msgid "Choose Tools - Macros - Digital Signature." msgstr "Vel Verktøy → Makroar → Digital signatur" #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN106F2\n" "help.text" msgid "Apply the signature as described above for documents." msgstr "Legg til signaturen slik som omtalt ovanfor for dokument." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_idN106F5\n" "help.text" msgid "When you open the Basic IDE that contains signed macros, you see an icon Icon in the status bar. You can double-click the icon in the status bar to view the certificate." msgstr "Når du opnar Basic-IDE-en som inneheld signerte makroar, kjem det opp eit ikon Ikon på statuslinja. Du kan dobbelklikka på dette ikonet om du vil sjå nærare på sertifikatet." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_id5734733\n" "help.text" msgid "Click to open the View Certificate dialog." msgstr "Klikk for å opna dialogvindauget «Vis sertifikat»." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_id561540\n" "help.text" msgid "Choose this setting to accept the certificate until you exit %PRODUCTNAME." msgstr "Vel denne innstillinga for å godta sertifikatet til du avsluttar %PRODUCTNAME." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_id7705618\n" "help.text" msgid "Choose this setting to cancel the connection." msgstr "Vel denne innstillinga for å avbryta tilkoplinga." #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_id3204443\n" "help.text" msgid "English Wiki page on digital signatures" msgstr "Engelsk Wikiside om digitale signaturar" #: digitalsign_send.xhp msgctxt "" "digitalsign_send.xhp\n" "par_id5166173\n" "help.text" msgid "About digital signatures" msgstr "Om digitale signaturar" #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "tit\n" "help.text" msgid "Saving Documents Automatically" msgstr "Lagra dokument automatisk" #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "bm_id3152924\n" "help.text" msgid "documents; saving automaticallysaving;documents, automaticallyautomatic savingbackups;automaticfiles; saving automaticallytext documents; saving automaticallyspreadsheets; saving automaticallydrawings; saving automaticallypresentations; saving automatically" msgstr "dokument; lagra automatisklagra;dokument, automatiskautomatisk lagringtryggingskopiar;automatiskefiler; lagra automatisktekstdokument; lagra automatiskrekneark; lagra automatiskteikningar; lagra automatiskpresentasjonar; lagra automatisk" #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "hd_id3155536\n" "2\n" "help.text" msgid "Saving Documents Automatically" msgstr "Lagra dokument automatisk" #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "hd_id3166410\n" "3\n" "help.text" msgid "To create a backup file every time you save a document" msgstr "Slik lagar du ein reservekopi av ei fil kvar gong du lagrar eit dokument" #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "par_id3152780\n" "4\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - Load/Save - General." msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Vis" #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "par_id3148474\n" "5\n" "help.text" msgid "Mark Always create backup copy." msgstr "Merk av for Lag alltid ein reservekopi." #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "par_id3149797\n" "6\n" "help.text" msgid "If the Always create backup copy option is selected, the old version of the file is saved to the backup directory whenever you save the current version of the file." msgstr "Viss du har vald Lag alltid ein reservekopi vert den gamle versjonen av fila lagra i mappa for tryggingskopiar kvar gong du lagrar den gjeldande versjonen av fila." #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "par_id3148685\n" "7\n" "help.text" msgid "You can change the backup directory by choosing %PRODUCTNAME - PreferencesTools - Options - $[officename] - Paths, then change the Backups path in the dialog." msgstr "For å endre kvar reservekopiane skal lagrast, vel %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → %PRODUCTNAME → Stiar og skriv inn ein ny sti for reservekopiane." #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "par_id3149415\n" "8\n" "help.text" msgid "The backup copy has the same name as the document, but the extension is .BAK. If the backup folder already contains such a file, it will be overwritten without warning." msgstr "Reservekopien har det same namnet som dokumentet, men har filtypen «.BAK». Vis mappa for reservekopiar inneheld ei fil med dette namnet frå før, vert denne overskrive utan varsel." #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "hd_id3149514\n" "9\n" "help.text" msgid "To save recovery information automatically every n minutes" msgstr "For å lagra gjenopprettingsinformasjon kvart n minutt" #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "par_id3148563\n" "10\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - Load/Save - General." msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Vis" #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "par_id3154760\n" "11\n" "help.text" msgid "Mark Save AutoRecovery information every and select the time interval." msgstr "Merk av for Lagra gjenopprettingsinformasjon kvart og vel tidsintervallet du vil bruka." #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "par_id3153526\n" "13\n" "help.text" msgid "This command saves the information necessary to restore the current document in case of a crash. Additionally, in case of a crash %PRODUCTNAME tries automatically to save AutoRecovery information for all open documents, if possible." msgstr "Denne kommandoen lagrar informasjonen som krevst for å gjenoppretta det gjeldande dokumentet viss programmet krasjar. Viss eit program krasjar, vil %PRODUCTNAME også prøva å lagra gjenopprettingsinformasjon for alle opne dokument om det er mogleg." #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "par_id3148672\n" "15\n" "help.text" msgid "Save As" msgstr "Ark" #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "par_id3159150\n" "16\n" "help.text" msgid "%PRODUCTNAME - PreferencesTools - Options - Load/Save - General" msgstr "%PRODUCTNAME → InnstillingarVerktøy → InnstillingarLast inn/lagra → Generelt" #: doc_autosave.xhp msgctxt "" "doc_autosave.xhp\n" "par_idN10838\n" "help.text" msgid "Error Report Tool" msgstr "Feilrapporteringsverktøy" #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "tit\n" "help.text" msgid "Opening Documents" msgstr "Opna dokument" #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "bm_id3147834\n" "help.text" msgid "opening; documentsdocuments; openingfiles; openingloading; documentsspreadsheets;creating/openingpresentations;creating/openingFTP; opening documentsnew documentsempty documentstext documents;creating/openingdrawings; creating/openingHTML documents; newformulas; new" msgstr "opna; dokumentdokument; opnafiler; opnalasta inn; dokumentrekneark; laga/opnapresentasjonar; laga/opnaFTP; opna dokumentnye dokumenttomme dokumenttekstdokument; laga/opnateikningar; laga/opnaHTML-dokument; nyeformlar; nye" #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "hd_id3147834\n" "1\n" "help.text" msgid "Opening Documents" msgstr "Opna dokument" #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "hd_id3147653\n" "12\n" "help.text" msgid "Opening an existing document" msgstr "Opna eit eksisterande dokument" #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id3149398\n" "2\n" "help.text" msgid "Do one of the following:" msgstr "Gjer éin av desse:" #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_idN107A9\n" "help.text" msgid "Choose File - Open" msgstr "Vel Fil → Opna." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_idN107AF\n" "help.text" msgid "Click the Open icon on the Standard toolbar" msgstr "Trykk på knappen Opna i standardverktøylinja." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_idN107B2\n" "help.text" msgid "Press CommandCtrl+O" msgstr "Trykk CmdCtrl + O." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id3150275\n" "3\n" "help.text" msgid "The Open dialog appears." msgstr "Dialogvindauget Opna kjem fram." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id3149164\n" "4\n" "help.text" msgid "Select the file you want to open and click Open." msgstr "Merk fila du vil opna og trykk på Opna." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "hd_id3149234\n" "13\n" "help.text" msgid "Restrict Files to Display" msgstr "Avgrens kva filer som skal visast" #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id3150985\n" "14\n" "help.text" msgid "To restrict the display of files in the Open dialog to a certain type select the corresponding File type from the list. Select All Files to display all files." msgstr "For å avgrensa kva filer som skal visast i dialogvindauget Opna til ein bestemt type, vel filtype i lista Filtype. For å visa alle filene, vel Alle filer." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "hd_id4651326\n" "help.text" msgid "Cursor Position" msgstr "Markørplassering" #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id5509201\n" "help.text" msgid "In general, all documents open with the cursor at the start of the document." msgstr "Som regel vert alle dokument opna med markøren plassert i byrjinga av dokumentet." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id6594744\n" "help.text" msgid "One exception appears when the author of a Writer text document saves and reopens a document: The cursor will be at the same position where it has been when the document was saved. This only works when the name of the author was entered in %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME - User Data." msgstr "Eitt unntak er når forfattaren av eit Writer-tekstdokument lagrar og opnar dokumentet igjen. Markøren vil då vera der han var då dokumentet vart lagra. Dette gjeld berre når namnet på forfattaren er skrive inn i %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → %PRODUCTNAME → Brukardata." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id3422650\n" "help.text" msgid "Press Shift+F5 to set the cursor to the last saved position." msgstr "Trykk Shift + F5 for å setja markøren til den siste lagra posisjonen." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "hd_id3148453\n" "17\n" "help.text" msgid "Opening an Empty Document" msgstr "Opna eit tomt dokument" #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id3147287\n" "19\n" "help.text" msgid "Click the New icon on the Standard bar or choose File - New. This opens a document of the document type specified." msgstr "Trykk på knappen Ny på standardverktøylinja eller vel Fil → Ny. Dette opnar eit dokument av den angjevne dokumenttypen." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id3153092\n" "20\n" "help.text" msgid "If you click the arrow next to the New icon, a submenu opens in which you can select another document type." msgstr "Viss du trykker på pila ved sida av knappen Ny, kjem det opp ein undermeny der du kan velja ein annan dokumenttype." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "hd_id0820200803501358\n" "help.text" msgid "System File Dialogs or %PRODUCTNAME Dialogs" msgstr "Fildialogvindauge for systemet eller %PRODUCTNAME-dialogvindauge" #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id0820200803501356\n" "help.text" msgid "On most operating systems, you can choose to use the system file dialogs or %PRODUCTNAME dialogs." msgstr "På dei fleste operativsystema kan du bruka systemfildialogvindauge eller %PRODUCTNAME-dialogvindauga." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id0820200803501429\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME - General to switch the type of open/save dialogs." msgstr "Vis Verktøy → Innstillingar → $[officename]." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id0820200803501449\n" "help.text" msgid "The %PRODUCTNAME dialogs support file download and upload using secure https connections." msgstr "%PRODUCTNAME-dialogvindauget støttar nedlasting og opplasting ved bruk av sikre HTTPS-tilkoblingar." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "hd_id0820200803501453\n" "help.text" msgid "Opening Files from a Web Server" msgstr "Opna filer frå ein vevtenar" #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id3153126\n" "9\n" "help.text" msgid "You can enter a URL in the File name box of the Open dialogs. The URL must start with file:/// or ftp:// or http://." msgstr "Du kan skriva inn ein URL i skrivefeltet Filnamn i dialogvindaugetOpna. URL-en må byrja med «file:///», «ftp://» eller «http://»." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id0820200803501548\n" "help.text" msgid "If you use the %PRODUCTNAME dialog, you can use the https:// prefix for a secure connection, and you can save a document on the web server." msgstr "Viss du brukar %PRODUCTNAME-dialogvindauget, du kan bruka HTTPS://-prefiksen for ei sikker tilkopling og du kan lagra eit dokument på vevtenaren." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_idN107C4\n" "help.text" msgid "When you open a file by a URL from the Windows file dialog, Windows will open a local copy of the file, located in the Internet Explorer cache. The %PRODUCTNAME file dialog opens a local copy of the file in the system's temp folder." msgstr "Når du opnar ei fil frå ei nettadresse med filvindauget frå Windows, vert det opna ein lokal kopi av fila. Denne ligg i mellomlageret til Internet Explorer. Med %PRODUCTNAME vert det opna ein lokal kopi av fila i systemmappa for mellombels filer." #: doc_open.xhp msgctxt "" "doc_open.xhp\n" "par_id3148616\n" "5\n" "help.text" msgid "File - Open" msgstr "Ark" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "tit\n" "help.text" msgid "Saving Documents" msgstr "Lagra dokument" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "bm_id3147226\n" "help.text" msgid "documents; savingsaving; documentsbackups; documentsfiles; savingtext documents; savingspreadsheets; savingdrawings; savingpresentations; savingFTP; saving documents" msgstr "dokument; lagralagra; dokumentreservekopiar; dokumentfiler; lagratekstdokument; lagrarekneark; lagrateikningar; lagrapresentasjonar; lagraFTP; lagra dokument" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "hd_id3147226\n" "4\n" "help.text" msgid "Saving Documents" msgstr "Lagra dokument" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id3156113\n" "5\n" "help.text" msgid "Click the Save icon or press the shortcut keys CommandCtrl+S." msgstr "Klikk på ikonet Lagra eller trykk snartastane Cmd Ctrl + S." #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id3155450\n" "help.text" msgid "This icon is for tips on how to use the program more effectively." msgstr "Dette ikonet er for tips om korleis du kan bruka programmet meir effektivt." #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id3148685\n" "8\n" "help.text" msgid "The document is saved under its path and name on the current local data medium or network drive or on the Internet, overwriting any file of the same name." msgstr "Dokumentet vert lagra i denne stien og med dette filnamnet på det gjeldande lagringsmediet som kan vera i datamaskinen, i eit nettverk eller på Internett. Viss det finst ei fil med det same namnet frå før, vert denne fila overskrive." #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id3150984\n" "2\n" "help.text" msgid "When you save a new file for the first time, the Save As dialog opens, in which you can enter a name, folder and drive or volume for the file. To open this dialog, choose File - Save As." msgstr "Når du lagrar ei ny fil for første gongen vert dialogvindauget Lagra som opna. Her kan du skriva inn filnamnet du vil bruka og velja mappa, stasjonen eller lagringsmediet der du vil lagra fila. Du kan også opna dette dialogvindauget ved å velja Fil → Lagra som." #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id3152472\n" "3\n" "help.text" msgid "You can set the automatic creation of a backup copy under %PRODUCTNAME - PreferencesTools - Options - Load/Save - General." msgstr "Du kan velja å laga reservekopi automatisk under %PRODUCTNAME → InnstillingarVerktøy → InnstillingarLast inn/Lagra → Generelt." #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "hd_id7146824\n" "help.text" msgid "Automatic extension to the file name" msgstr "Automatisk filutviding til filnamnet" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id9359111\n" "help.text" msgid "When saving a file, %PRODUCTNAME always appends an extension to the file name, except when the file name already has an extension that matches the file type. See the list of ODF extensions." msgstr "Når du lagrar ei fil vil %PRODUCTNAME alltid leggja til filetternamnet i filnamnet, unntatt når fila alt har eit namn som stemmer med filtypen. Sjå lista over ODF-filetternamn." #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id6709494\n" "help.text" msgid "Some examples for the automatic extensions are listed in the following table:" msgstr "Tabellen viser nokre eksempel på automatiske filetternamn:" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id9009674\n" "help.text" msgid "You enter this file name" msgstr "Du skriv inn dette filnamnet" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id485549\n" "help.text" msgid "You select this file type" msgstr "Du vel denne filtypen" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id3987243\n" "help.text" msgid "File is saved with this name" msgstr "Fila vert lagra med dette namnet" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id7681814\n" "help.text" msgid "my file" msgstr "mi fil" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id9496749\n" "help.text" msgid "ODF Text" msgstr "ODF-tekst" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id342417\n" "help.text" msgid "my file.odt" msgstr "mi fil.odt" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id5087130\n" "help.text" msgid "my file.odt" msgstr "mi fil.odt" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id7523728\n" "help.text" msgid "ODF Text" msgstr "ODF-tekst" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id8994109\n" "help.text" msgid "my file.odt" msgstr "mi fil.odt" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id266426\n" "help.text" msgid "my file.txt" msgstr "mi fil.txt" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id3031098\n" "help.text" msgid "ODF Text" msgstr "ODF-tekst" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id8276619\n" "help.text" msgid "my file.txt.odt" msgstr "mi fil.txt.odt" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id7824030\n" "help.text" msgid "my file.txt" msgstr "mi fil.txt" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id7534104\n" "help.text" msgid "Text (.txt)" msgstr "Tekst (.txt)" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id209051\n" "help.text" msgid "my file.txt" msgstr "mi fil.txt" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id3153524\n" "6\n" "help.text" msgid "Save As" msgstr "Ark" #: doc_save.xhp msgctxt "" "doc_save.xhp\n" "par_id3154140\n" "7\n" "help.text" msgid "%PRODUCTNAME - PreferencesTools - Options - Load/Save - General" msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Vis" #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "tit\n" "help.text" msgid "Dragging and Dropping Within a $[officename] Document" msgstr "Dra og sleppa i eit $[officename]-dokument" #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "bm_id3154927\n" "help.text" msgid "drag and drop;overviewmouse; pointers when using drag and droplinks;by drag and dropcopying;by drag and drop" msgstr "dra og sleppa;oversiktmus; peikarar når dra og slepp vert bruklenkjer; laga med dra og sleppkopiera; med dra og slepp" #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "hd_id3147571\n" "11\n" "help.text" msgid "Dragging and Dropping Within a $[officename] Document" msgstr "Dra og sleppa i eit $[officename]-dokument" #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3147008\n" "3\n" "help.text" msgid "There are many options for moving or copying objects using drag-and-drop. Text sections, drawing objects, graphics, form controls, hyperlinks, cell ranges, and many more can be moved or copied with the mouse." msgstr "Det er mange val for flytting eller kopiering av objekt ved bruk av dra og slepp. Tekstdelar, teikningar, bilete, skjemakontrollelement, hyperlenkjer, celleområde og mange fleire kan flyttast eller kopierast med musa." #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3155892\n" "12\n" "help.text" msgid "Note that the mouse pointer displays a plus sign when copying and an arrow when creating a link or hyperlink." msgstr "Legg merkje til at musepeikaren viser eit plussteikn når du kopierer og ei pil når du lagar ei lenkje eller ei hyperlenkje." #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3146798\n" "5\n" "help.text" msgid "Mouse Pointer" msgstr "Musepeikar" #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3147618\n" "6\n" "help.text" msgid "Description" msgstr "Skildring" #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3159177\n" "help.text" msgid "Mouse pointer moving data" msgstr "Musepeikar når data vert flytt" #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3154898\n" "7\n" "help.text" msgid "Moving" msgstr "Flytting" #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3154306\n" "help.text" msgid "Mouse pointer copying data" msgstr "Kopiere data med musepeikaren" #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3153627\n" "8\n" "help.text" msgid "Copying" msgstr "Kopierer" #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3153896\n" "help.text" msgid "Mouse pointer inserting link" msgstr "Setja inn lenkje med musepeikaren" #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3154938\n" "9\n" "help.text" msgid "Creating a link" msgstr "Laga ei lenkje" #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3154366\n" "13\n" "help.text" msgid "If you press CommandCtrl or Shift+CommandCtrl while releasing the mouse button, you can control whether the object is copied, moved, or a link is created." msgstr "Viss du trykker CmdCtrl eller Shift + CmdCtrl når du slepp museknappen, kan du kontrollera om objektet er kopiert, flytta eller lenkja." #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3148672\n" "help.text" msgid "Icon" msgstr "Ikon" #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3156422\n" "14\n" "help.text" msgid "If you drag objects out of the Navigator, you can specify in the submenu of the Navigator's Drag Mode icon whether to copy the object, insert it as a link or insert it as a hyperlink." msgstr "Viss du drar objekt ut av dokumentstrukturen, kan du angje i undermenyen til Dokumentstruktur → Dramodus-ikonet om du vil kopiera objektet, setja det inn som ei lenkje eller setja det inn som ei hyperlenkje." #: dragdrop.xhp msgctxt "" "dragdrop.xhp\n" "par_id3153144\n" "4\n" "help.text" msgid "You can cancel a drag-and-drop operation in $[officename] at any time by pressing the Esc key before releasing the mouse button." msgstr "Du kan når som helst avbryta dra og sepp i $[officename] ved å trykka Esc-tasten før du slepp opp museknappen." #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "tit\n" "help.text" msgid "Drag-and-Drop With the Data Source View" msgstr "Dra og sleppa i datakjeldevisinga" #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "bm_id3145071\n" "help.text" msgid "drag and drop; data source viewdata source view; drag and dropcopying;from data source viewpasting;from data source view" msgstr "dra og sleppe; datakjeldevisingdatakjeldevising; dra og sleppekopiera; frå datakjeldevisinglima inn; frå datakjeldevising" #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "hd_id3145071\n" "10\n" "help.text" msgid "Drag-and-Drop With the Data Source View" msgstr "Dra og sleppe i datakjeldevisinga" #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "par_id3151111\n" "34\n" "help.text" msgid "A fast way of copying from a data source into a text or spreadsheet document, or of creating forms based on a data source, is by drag-and-drop." msgstr "Med dra og slepp kan du raskt kopiera frå ei datakjelde til eit tekstdokument eller eit rekneark eller laga skjema på grunnlag av ei datakjelde." #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "par_id3147335\n" "help.text" msgid "Mouse pointer copying data" msgstr "Kopiere data med musepeikaren" #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "par_id3145315\n" "35\n" "help.text" msgid "Copying with Drag-and-Drop" msgstr "Kopiera med dra og slepp" #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "par_id3149233\n" "28\n" "help.text" msgid "If you want to reverse a drag-and-drop, position the cursor in your document and choose Edit - Undo." msgstr "Viss du angrar på at du har brukt dra og slepp, kan du setja markøren i dokumentet og velja Rediger → Angra." #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "par_id3149656\n" "46\n" "help.text" msgid "It is also possible to copy by drag-and-drop from a document into a data source:" msgstr "Du kan også bruke dra og slepp til å kopiera frå eit dokument til ei datakjelde:" #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "par_id3153379\n" "47\n" "help.text" msgid "A text table or the selected range of a spreadsheet can be dragged using drag-and-drop to a table container in the data source explorer." msgstr "Ein teksttabell eller det merkte området i eit rekneark kan dragast ved å bruka dra og slepp til ein tabellhaldar i datakjeldeutforskaren." #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "par_id3151211\n" "48\n" "help.text" msgid "Plain text can be copied using drag-and-drop from one document to a data field in the data source view." msgstr "Du kan bruka dra og slepp til å kopiera rein tekst frå eit dokument til eit datafelt i datakjeldevisinga." #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "hd_id3145421\n" "36\n" "help.text" msgid "Using data in a text document" msgstr "Bruka data i eit tekstdokument" #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "par_id3154685\n" "12\n" "help.text" msgid "You can insert a database field in a text document by dragging a field name from the column header of the data source view into the document. This is especially useful when designing form letters. Simply drag the desired fields - home address, form of address, and so on - into your document." msgstr "Du kan setja inn eit databasefelt i eit tekstdokument ved å dra eit feltnamn frå kolonneoverskrifta i datakjeldevisinga til dokumentet. Dette er spesielt nyttig når du lagar standardbrev. Du kan ganske enkelt dra felta du vil bruka, for eksempel heimeadresse, tiltaleform og anna, inn i dokumentet." #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "par_id3153105\n" "37\n" "help.text" msgid "To insert a complete record, select the corresponding header and drag it into the document. When you release the mouse button, the Insert database columns dialog appears, in which you can decide whether to use all database fields, and whether to copy the data into the document as text, a table or fields. All currently selected records will be inserted." msgstr "Viss du vil setja inn ein hel post, kan du merka den tilsvarande overskrifta og dra ho inn i dokumentet. Når du slepp opp museknappen, kjem dialogvindauget Set inn databasekolonnar fram. Her kan du velja om du vil bruka alle databasefelta og om du vil kopiera dataane til dokumentet som tekst, som ein tabell eller som felt. Alle postane du har merkt vert sette inn." #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "hd_id3147230\n" "39\n" "help.text" msgid "Applying data to a table document" msgstr "Leggja til data i eit tabelldokument" #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "par_id3125864\n" "40\n" "help.text" msgid "You can insert one or more records into the current sheet of a spreadsheet by selecting the rows in the data source view and dragging and dropping them into the spreadsheet. The data is inserted at the place where you release the mouse button." msgstr "Du kan setja inn ein eller fleire postar i det gjeldande arket i eit rekneark ved å merka radene i datakjeldevisinga og dra og sleppa dei i reknearket. Dataane vert sette inn der markøren er plassert når du slepp opp museknappen." #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "hd_id3149766\n" "42\n" "help.text" msgid "Inserting controls in a text form" msgstr "Setja inn kontrollelement i eit tekstskjema" #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "par_id3155132\n" "43\n" "help.text" msgid "When you create a text form linked to a database, you can generate controls by drag-and-drop from the data source view." msgstr "Når du lagar eit tekstskjema som er lenkja til ein database, kan du laga kontrollelement ved å dra og sleppa frå datakjeldevisinga." #: dragdrop_beamer.xhp msgctxt "" "dragdrop_beamer.xhp\n" "par_id3149562\n" "45\n" "help.text" msgid "When you drag a database column into the text document, you insert a field. If you hold down Shift+CommandCtrl while dragging, a text field is inserted, grouped with an appropriate label field. The text field already contains all the database information that you need for the form." msgstr "Når du drar ein databasekolonne inn i eit tekstdokument, set du inn eit felt. Viss du trykker Shift + Cmd Ctrl samstundes som du drar, vert det sett inn eit tekstfelt gruppert med eit passande etikettfelt. Tekstfeltet inneheld databaseinformasjonen du treng for skjemaet." #: dragdrop_fromgallery.xhp msgctxt "" "dragdrop_fromgallery.xhp\n" "tit\n" "help.text" msgid "Copying Graphics From the Gallery" msgstr "Kopiera bilete frå galleriet" #: dragdrop_fromgallery.xhp msgctxt "" "dragdrop_fromgallery.xhp\n" "bm_id3145345\n" "help.text" msgid "Gallery;dragging pictures to draw objectsdraw objects;dropping Gallery picturesdrag and drop;from Gallery to draw objects" msgstr "galleri; dra bilete til teikneobjektteikneobjekt; dra bilete frå gallerietdra og sleppe; frå galleriet til teikneobjekt" #: dragdrop_fromgallery.xhp msgctxt "" "dragdrop_fromgallery.xhp\n" "hd_id3145345\n" "40\n" "help.text" msgid "Copying Graphics From the Gallery" msgstr "Kopiera bilete frå galleriet" #: dragdrop_fromgallery.xhp msgctxt "" "dragdrop_fromgallery.xhp\n" "par_id3155535\n" "41\n" "help.text" msgid "If you drag a graphic from the Gallery into a text, spreadsheet or presentation document, the graphic will be inserted there." msgstr "Viss du drar eit bilete frå galleriet til eit tekstdokument, eit rekneark eller ein presentasjon, vert biletet sett inn i dette dokumentet." #: dragdrop_fromgallery.xhp msgctxt "" "dragdrop_fromgallery.xhp\n" "par_id3149762\n" "45\n" "help.text" msgid "If you release the graphic directly on a draw object, please note the following:" msgstr "Viss du slepp biletet direkte på eit teikneobjekt, må du vera merksam på dette:" #: dragdrop_fromgallery.xhp msgctxt "" "dragdrop_fromgallery.xhp\n" "par_id3153825\n" "43\n" "help.text" msgid "If you move the graphic (drag it without pressing any key, in which case no additional symbol appears next to the mouse pointer), only the attributes are copied from the graphic and applied to the draw object on which you release the mouse button." msgstr "Viss du flyttar biletet (drar det utan å halde nede ein tast, altså utan at det vert vist eit symbol ved sida av peikaren) vert berre eigenskapane kopierte frå biletet og lagt til det teikneobjektet som du slepp det i." #: dragdrop_fromgallery.xhp msgctxt "" "dragdrop_fromgallery.xhp\n" "par_id3153665\n" "42\n" "help.text" msgid "If you copy the graphic (drag it while holding down the CommandCtrl key, in which case a plus sign appears next to the mouse pointer), the graphic will be inserted as an object." msgstr "Viss du kopierer biletet (drar medan du held nede CmdCtrl, vist med eit plussteikn ved sida av peikaren), vert biletet sett inn som eit objekt." #: dragdrop_fromgallery.xhp msgctxt "" "dragdrop_fromgallery.xhp\n" "par_id3154514\n" "44\n" "help.text" msgid "If you create a hyperlink (drag while holding down Shift and CommandCtrl, in which case a linking arrow appears next to the mouse pointer), the drawing object is replaced by the graphic from the Gallery, but the position and size of the replaced draw object are retained." msgstr "Viss du lagar ei hyperlenkje (drar medan du held nede Shift og CmdCtrl, vist med ei lenkjepil ved sida av peikaren), vert teikneobjektet byt ut med biletet frå galleriet, men plasseringa og storleiken på det fjerna teikneobjektet er uendra." #: dragdrop_gallery.xhp msgctxt "" "dragdrop_gallery.xhp\n" "tit\n" "help.text" msgid "Adding Graphics to the Gallery" msgstr "Leggja til bilete i galleriet" #: dragdrop_gallery.xhp msgctxt "" "dragdrop_gallery.xhp\n" "bm_id3154927\n" "help.text" msgid "drag and drop;to Gallerycopying;to GalleryGallery; adding picturespictures;adding to Galleryinserting;pictures in Gallerypasting;to Gallery" msgstr "dra og sleppe; til gallerietkopiera; til gallerietgalleriet; leggja til bilete ibilete; leggja til i gallerietsetja inn; bilete i gallerietlima inn; i galleriet" #: dragdrop_gallery.xhp msgctxt "" "dragdrop_gallery.xhp\n" "hd_id3154927\n" "49\n" "help.text" msgid "Adding Graphics to the Gallery " msgstr "Leggja til bilete i galleriet " #: dragdrop_gallery.xhp msgctxt "" "dragdrop_gallery.xhp\n" "par_id3143267\n" "50\n" "help.text" msgid "You can place a graphic from a document such as an HTML page in the Gallery by drag-and-drop." msgstr "Du kan bruka dra og slepp til å kopiere eit bilete frå eit dokument, for eksempel ei HTML-side, til galleriet." #: dragdrop_gallery.xhp msgctxt "" "dragdrop_gallery.xhp\n" "par_id3154823\n" "56\n" "help.text" msgid "Display the Gallery theme to which you want to add the graphic." msgstr "Vel galleritemaet der du vil leggja til biletet." #: dragdrop_gallery.xhp msgctxt "" "dragdrop_gallery.xhp\n" "par_id3153748\n" "51\n" "help.text" msgid "Position the mouse pointer above the graphic, without clicking." msgstr "Plasser musepeikaren over biletet, men ikkje klikk på det." #: dragdrop_gallery.xhp msgctxt "" "dragdrop_gallery.xhp\n" "par_id3156346\n" "52\n" "help.text" msgid "If the mouse pointer changes to a hand symbol, the graphic refers to a hyperlink. In this case, click the graphic while pressing the OptionAlt key to select it without executing the respective link." msgstr "Viss peikaren vert endra til eit handsymbol, viser biletet til ei hyperlenkje. Du kan då klikka på eit bilete medan du trykkjer Val Alt for å merka biletet utan å opna lenkja det viser til." #: dragdrop_gallery.xhp msgctxt "" "dragdrop_gallery.xhp\n" "par_id3149578\n" "53\n" "help.text" msgid "If the mouse pointer does not change to a hand symbol, you can simply click the graphic to select it." msgstr "Viss peikaren ikkje vert endra til eit handsymbol, kan du ganske enkelt klikka på biletet for å merka det." #: dragdrop_gallery.xhp msgctxt "" "dragdrop_gallery.xhp\n" "par_id3145120\n" "54\n" "help.text" msgid "Once the graphic is selected, release the mouse button. Click again on the graphic image, keeping the mouse button pressed for more than two seconds. The graphic image is copied to the internal memory." msgstr "Slepp opp museknappen når biletet er merkt. Klikk på biletet igjen og hald museknappen inne i meir enn to sekund. Biletet vert kopiert til internminnet." #: dragdrop_gallery.xhp msgctxt "" "dragdrop_gallery.xhp\n" "par_id3150772\n" "55\n" "help.text" msgid "Without releasing the mouse button, drag the graphic into the Gallery." msgstr "Dra biletet til galleriet utan å sleppa museknappen." #: dragdrop_graphic.xhp msgctxt "" "dragdrop_graphic.xhp\n" "tit\n" "help.text" msgid "Copying Graphics Between Documents" msgstr "Kopiera bilete mellom dokument" #: dragdrop_graphic.xhp msgctxt "" "dragdrop_graphic.xhp\n" "bm_id3159201\n" "help.text" msgid "drag and drop; picturespictures; drag and drop between documentscopying;pictures, between documentspasting;pictures from other documents" msgstr "dra og slepp; bilderbilete; dra og sleppa mellom dokumentkopiera; bilete, mellom dokumentlima inn; bilete frå andre dokument" #: dragdrop_graphic.xhp msgctxt "" "dragdrop_graphic.xhp\n" "hd_id3159201\n" "15\n" "help.text" msgid "Copying Graphics Between Documents" msgstr "Kopiera bilete mellom dokument" #: dragdrop_graphic.xhp msgctxt "" "dragdrop_graphic.xhp\n" "par_id3155805\n" "16\n" "help.text" msgid "You can copy a graphic from one document to another by drag-and-drop. If you plan to publish your document, please observe copyright laws and obtain the consent of the authors." msgstr "Du kan kopiera eit bilete frå eit dokument til eit anna ved å bruka dra og slepp. Viss du har planar om å publisera dokumentet, må du vera merksam på lover om opphavsrett og få løyve frå dei som har opphavsretten til bileta." #: dragdrop_graphic.xhp msgctxt "" "dragdrop_graphic.xhp\n" "par_id3147576\n" "17\n" "help.text" msgid "Open the document in which you want to insert the graphic object." msgstr "Opna dokumentet du vil setja biletobjektet inn i." #: dragdrop_graphic.xhp msgctxt "" "dragdrop_graphic.xhp\n" "par_id3155338\n" "18\n" "help.text" msgid "Open the document from which you want to copy the graphic." msgstr "Opna dokumentet som inneheld biletet du vil kopiera." #: dragdrop_graphic.xhp msgctxt "" "dragdrop_graphic.xhp\n" "par_id3149182\n" "19\n" "help.text" msgid "Click the graphic while pressing the OptionAlt key, to select it without executing any hyperlinks it may refer to." msgstr "Klikk på biletet samstundes som du trykker Val Alt for å merka det utan å opna hyperlenkja det viser til." #: dragdrop_graphic.xhp msgctxt "" "dragdrop_graphic.xhp\n" "par_id3151110\n" "20\n" "help.text" msgid "Keep the mouse button pressed and wait a moment while the object is copied to an internal memory." msgstr "Hald museknappen inne og vent medan objektet vert kopiert til internminnet." #: dragdrop_graphic.xhp msgctxt "" "dragdrop_graphic.xhp\n" "par_id3149763\n" "21\n" "help.text" msgid "Drag the graphic into the other document. If the documents are not visible side by side, first move the mouse pointer to the button of the target document while keeping the mouse button pressed. The document in question is then displayed and you can move the mouse pointer into the document. " msgstr "Dra biletet inn i det andre dokumentet. Viss dokumenta ikkje vert viste side ved side, må du først flytta musepeikaren til knappen i måldokumentet, samstundes som du held museknappen nede. Det aktuelle dokumentet vert vist, og du kan flytta peikaren til det. " #: dragdrop_graphic.xhp msgctxt "" "dragdrop_graphic.xhp\n" "par_id3155628\n" "22\n" "help.text" msgid "Release the mouse button as soon as the gray text cursor indicates the position where you want to insert a copy of the picture." msgstr "Slipp museknappen når den grå tekstmarkøren er plassert der du vil setja inn ein kopi av biletet." #: dragdrop_graphic.xhp msgctxt "" "dragdrop_graphic.xhp\n" "par_id3150276\n" "56\n" "help.text" msgid "If the graphic is connected with a hyperlink, the hyperlink and not the graphic is inserted." msgstr "Viss biletet er kopla med ei hyperlenkje, vert hyperlenkja sett inn i staden for biletet." #: dragdrop_table.xhp msgctxt "" "dragdrop_table.xhp\n" "tit\n" "help.text" msgid "Copying Spreadsheet Areas to Text Documents" msgstr "Kopiera reknearksområde til tekstdokument" #: dragdrop_table.xhp msgctxt "" "dragdrop_table.xhp\n" "bm_id3154927\n" "help.text" msgid "spreadsheets; copying areas to text documentscopying; sheet areas, to text documentspasting;sheet areas in text documents" msgstr "rekneark; kopiera område til tekstdokumentkopiera; arkområde til tekstdokumentlima inn; arkområde i tekstdokument" #: dragdrop_table.xhp msgctxt "" "dragdrop_table.xhp\n" "hd_id3154927\n" "24\n" "help.text" msgid "Copying Spreadsheet Areas to Text Documents" msgstr "Kopiera reknearkområde til tekstdokument" #: dragdrop_table.xhp msgctxt "" "dragdrop_table.xhp\n" "par_id3155892\n" "25\n" "help.text" msgid "Open both the text document and the spreadsheet." msgstr "Opna både tekstdokumentet og reknearket." #: dragdrop_table.xhp msgctxt "" "dragdrop_table.xhp\n" "par_id3147088\n" "26\n" "help.text" msgid "Select the sheet area you want to copy." msgstr "Merk arkområdet du vil kopiera." #: dragdrop_table.xhp msgctxt "" "dragdrop_table.xhp\n" "par_id3149827\n" "27\n" "help.text" msgid "Point to the selected area and press the mouse button. Keep the mouse button pressed for a moment, then drag the area into the text document." msgstr "Peik på det merkte området og trykk på museknappen. Hald museknappen inne eit par sekund og dra deretter området inn i tekstdokumentet." #: dragdrop_table.xhp msgctxt "" "dragdrop_table.xhp\n" "par_id3152780\n" "32\n" "help.text" msgid "If the documents are not visible next to each other, first drag the mouse pointer to the destination document button. Continue to hold down the mouse button. The document is displayed, and you can move the mouse pointer within the document. " msgstr "Viss dokumenta ikkje vert viste side ved side, må du først flytta musepeikaren til knappen i måldokumentet medan du held inne museknappen. Det andre dokumentet kjem fram, og du kan flytta peikaren til det." #: dragdrop_table.xhp msgctxt "" "dragdrop_table.xhp\n" "par_id3156346\n" "28\n" "help.text" msgid "Once the cursor is located in the place where you want to insert the sheet area, release the mouse button. The sheet area is inserted as an OLE object." msgstr "Når peikaren er plassert der du vil setja inn området frå arkområdet, slepp du knappen. Arkområdet vert sett inn som eit OLE-objekt." #: dragdrop_table.xhp msgctxt "" "dragdrop_table.xhp\n" "par_id3154047\n" "29\n" "help.text" msgid "You can select and edit the OLE object at any time." msgstr "Du kan når som helst merka og redigera OLE-objektet." #: dragdrop_table.xhp msgctxt "" "dragdrop_table.xhp\n" "par_id3149164\n" "30\n" "help.text" msgid "To edit the OLE object, double-click on it." msgstr "Du kan redigera OLE-objektet ved å dobbeltklikka på det." #: dragdrop_table.xhp msgctxt "" "dragdrop_table.xhp\n" "par_id3155389\n" "33\n" "help.text" msgid "Alternatively, select the object and choose Edit - Object - Edit or choose Edit from the context menu. You edit the object in its own frame within the text document, but you see the icons and menu commands needed for spreadsheets." msgstr "Du kan også merka objektet og bruka Rediger → Objekt → Rediger eller velja Rediger frå sprettoppmenyen. Objektet vert redigert i si eiga ramme inne i tekstdokumentet, men du vil sjå knappane og menykommandoane du treng for rekneark." #: dragdrop_table.xhp msgctxt "" "dragdrop_table.xhp\n" "par_id3154860\n" "31\n" "help.text" msgid "Choose Open to open the source document of the OLE object." msgstr "Vel Opna for å opna kjeldedokumentet for OLE-objektet." #: edit_symbolbar.xhp msgctxt "" "edit_symbolbar.xhp\n" "tit\n" "help.text" msgid "Adding Buttons to Toolbars" msgstr "Leggja til knappar på verktøylinjer" #: edit_symbolbar.xhp msgctxt "" "edit_symbolbar.xhp\n" "bm_id3159201\n" "help.text" msgid "customizing; toolbarsbuttons;toolbarstoolbars;adding buttonsconfiguring; toolbarsediting; toolbarsinserting;buttons in toolbars" msgstr "tilpassa; verktøylinjerknappar;verktøylinjerverktøylinjer;leggja til knapparsetja opp; verktøylinjerredigera; verktøylinjersetja inn;knappar i verktøylinjer" #: edit_symbolbar.xhp msgctxt "" "edit_symbolbar.xhp\n" "hd_id3159201\n" "79\n" "help.text" msgid "Adding Buttons to Toolbars" msgstr "Leggja til knappar på verktøylinjer" #: edit_symbolbar.xhp msgctxt "" "edit_symbolbar.xhp\n" "hd_id3153561\n" "85\n" "help.text" msgid "To add a button to a toolbar:" msgstr "Slik legg du til ein knapp i ei verktøylinje:" #: edit_symbolbar.xhp msgctxt "" "edit_symbolbar.xhp\n" "par_id3159157\n" "78\n" "help.text" msgid "Open the context menu of the toolbar (right click) and choose Visible Buttons and then select the button you want to display." msgstr "Opna sprettoppmenyen for verktøylinja (høgreklikk) og vel Synlege knappar og vel der knappen du vil visa." #: edit_symbolbar.xhp msgctxt "" "edit_symbolbar.xhp\n" "par_id2439039\n" "help.text" msgid "Opens a dialog where you can add, edit, and remove icons." msgstr "Opnar eit dialogvindauge der du kan leggja til, redigera og fjerna knappar." #: edit_symbolbar.xhp msgctxt "" "edit_symbolbar.xhp\n" "hd_id3151384\n" "86\n" "help.text" msgid "To add a button to the list of Visible Buttons:" msgstr "Slik legg du til ein knapp i lista over synlege knappar:" #: edit_symbolbar.xhp msgctxt "" "edit_symbolbar.xhp\n" "par_id3147264\n" "87\n" "help.text" msgid "Choose Tools - Customize, and click on the Toolbars tab." msgstr "Vel Verktøy → Tilpass og trykk på fana Verktøylinjer." #: edit_symbolbar.xhp msgctxt "" "edit_symbolbar.xhp\n" "par_id3154071\n" "88\n" "help.text" msgid "In the Toolbars box, select the toolbar you want to change." msgstr "Merk verktøylinja du vil endra i listeboksen Verktøylinje." #: edit_symbolbar.xhp msgctxt "" "edit_symbolbar.xhp\n" "par_id3148797\n" "89\n" "help.text" msgid "Click Add Commands , select the new command, then click Add." msgstr "Klikk på Legg til kommandoar, merk den nye kommandoen og trykk på Legg til." #: edit_symbolbar.xhp msgctxt "" "edit_symbolbar.xhp\n" "par_id3152922\n" "90\n" "help.text" msgid "If you want, you can rearrange the Commands list by selecting a command name and clicking Move Up and Move Down." msgstr "Du kan også bruka lista Kommandoar til å endra rekkjefølgja elementa vert viste i. Merk ein kommando og bruk knappane Pil opp og Pil ned til å endra rekkjefølgja." #: edit_symbolbar.xhp msgctxt "" "edit_symbolbar.xhp\n" "par_id3145171\n" "91\n" "help.text" msgid "Click OK." msgstr "Trykk OK." #: email.xhp msgctxt "" "email.xhp\n" "tit\n" "help.text" msgid "Sending Documents as E-mail" msgstr "Senda dokument som e-postvedlegg" #: email.xhp msgctxt "" "email.xhp\n" "bm_id3153345\n" "help.text" msgid "documents; sending as e-mailsending; documents as e-maile-mail attachmentsfiles; sending as e-mailtext documents;sending as e-mailspreadsheets; sending as e-maildrawings; sending as e-mailpresentations; sending as e-mailattachments in e-mails" msgstr "dokument; sende som e-postsende; dokument som e-poste-postvedleggfiler; senda som e-posttekstdokument;senda som e-postrekneark; senda som e-postteikningar; senda som e-postpresentasjonar; senda som e-postvedlegg i e-post" #: email.xhp msgctxt "" "email.xhp\n" "hd_id3153345\n" "1\n" "help.text" msgid "Sending Documents as E-mail" msgstr "Senda dokument som e-postvedlegg" #: email.xhp msgctxt "" "email.xhp\n" "par_id3154897\n" "2\n" "help.text" msgid "Working in $[officename], you can send the current document as an e-mail attachment." msgstr "Når du arbeider med $[officename], kan du senda det gjeldande dokumentet som eit vedlegg i e-post." #: email.xhp msgctxt "" "email.xhp\n" "par_id3147335\n" "3\n" "help.text" msgid "Choose File - Send - E-mail Document." msgstr "Vel Fil → Send → E-postdokument." #: email.xhp msgctxt "" "email.xhp\n" "par_id3153127\n" "4\n" "help.text" msgid "$[officename] opens your default e-mail program. If you want to send the current document with another e-mail program, you can select the program to use with Internet - E-mail in the Options dialog box." msgstr "$[officename] vil opna standardprogrammet for e-post. Ønskjer du å senda det gjeldande dokumentet med eit anna e-postprogram, vel du programmet som skal brukast med Internett → E-post i dialogvindauget for innstillingar." #: email.xhp msgctxt "" "email.xhp\n" "par_id3150986\n" "5\n" "help.text" msgid "In your e-mail program, enter the recipient, subject and any text you want to add, then send the e-mail." msgstr "I e-postprogrammet skriv du inn mottakaren, emnet og teksten du vil leggja til og sender e-posten." #: email.xhp msgctxt "" "email.xhp\n" "par_id3595385\n" "help.text" msgid "In case you want to send the e-mail to a recipient who only has software that cannot read the OpenDocument format, you can send the current document in an often used proprietary format.
For a text document, choose File - Send - E-mail as Microsoft Word. For a spreadsheet, choose File - Send - E-mail as Microsoft Excel. And for a presentation, choose File - Send - E-mail as Microsoft PowerPoint.
If you want to send the document as a read-only file, choose File - Send - E-mail as PDF.
These commands do not change your current document. Only a temporary copy is created and sent." msgstr "Dersom du vil senda e-posten til ein mottakar som ikkje har program for å opna OpenDocument-formatet, kan du senda dokumentet i eit mykje brukt merkevareprodukt sitt format.
For tekstdokument vel du for eksempel Fil → Send → E-post som Microsoft Word. For rekneark kan du velja Fil → Send → E-post som Microsoft Excel og for presentasjonar via Fil → Send → E-post som Microsoft PowerPoint.
Ønskjer du å senda dokumentet i eit skriveverna format, vel Fil → Send → E-post som PDF.
Desse kommandoane endrar ikkje dokumentet. Det som vert sendt er ein mellombels kopi." #: error_report.xhp msgctxt "" "error_report.xhp\n" "tit\n" "help.text" msgid "Error Report Tool" msgstr "Feilmeldingsverktøy" #: error_report.xhp msgctxt "" "error_report.xhp\n" "bm_id3150616\n" "help.text" msgid "Error Report Tool reports;error reports crash reports activating;Error Report Tool" msgstr "Feilmeldingsverktøy rapportar;feilmeldingar krasjrapportar slå på;feilmeldingsverktøy" #: error_report.xhp msgctxt "" "error_report.xhp\n" "hd_id3150616\n" "17\n" "help.text" msgid "Error Report Tool" msgstr "Feilmeldingssverktøyet" #: error_report.xhp msgctxt "" "error_report.xhp\n" "par_id3153345\n" "1\n" "help.text" msgid "The Error Report Tool starts automatically when a program crash occurs." msgstr "Feilmeldingsverktøyet vert opna automatisk når eit program krasjar." #: error_report.xhp msgctxt "" "error_report.xhp\n" "par_id3147088\n" "2\n" "help.text" msgid "The Error Report Tool gathers all necessary information that can help the program developers to improve the code, so that in later versions this error can possibly be avoided. Please help us to improve the software and send the generated error report." msgstr "Feilmeldingsverktøyet samlar inn all informasjon som programutviklarane treng for å gjera koden betre, slik at dei kan hindra at den same feilen oppstår i seinare versjonar av programmet. Vi oppfordrar deg til å senda inn feilmeldinga som vert laga. På denne måten hjelper du oss til å gjera programma betre." #: error_report.xhp msgctxt "" "error_report.xhp\n" "hd_id3148538\n" "4\n" "help.text" msgid "Starting the Error Report Tool" msgstr "Starta feilrapporteringsverktøyet" #: error_report.xhp msgctxt "" "error_report.xhp\n" "par_id3149811\n" "5\n" "help.text" msgid "With most program crashes the Error Report Tool will start automatically." msgstr "Ved dei fleste programkrasja vil feilrapporteringsverktøyet starta automatisk." #: error_report.xhp msgctxt "" "error_report.xhp\n" "hd_id3154046\n" "7\n" "help.text" msgid "Completing the Report" msgstr "Fylla ut rapporten" #: error_report.xhp msgctxt "" "error_report.xhp\n" "par_id3147335\n" "8\n" "help.text" msgid "On the main Error Report Tool dialog, you can enter some additional information that may help the developers to localize the error. For example, if the error only appears after a change in your hardware or software environment, or if you clicked on a button, please include that information." msgstr "I hovuddialogvindauget til feilrapporteringsverktøyet kan du skriva inn ekstra informasjon som kan hjelpa utviklarane til å finna feilen. Viss feilen for eksempel berrre oppstår når du gjer endringar i maskinvaren eller i programvaremiljøet, eller viss feilen berre oppstår når du klikkar på éin bestemt knapp, ber vi deg om å ta med informasjon om dette." #: error_report.xhp msgctxt "" "error_report.xhp\n" "hd_id3159399\n" "9\n" "help.text" msgid "Sending the Error Report" msgstr "Sender feilrapporten" #: error_report.xhp msgctxt "" "error_report.xhp\n" "par_id3150504\n" "10\n" "help.text" msgid "The Error Report Tool uses the HTTP PUT / SOAP protocol to send the report data. You may optionally enter some descriptive text that will help us to identify the context of the program crash. Then click the Send button." msgstr "Feilrapporteringsverktøyet brukar HTTP PUT / SOAP-protokollen til å senda rapportdataane. Du kan også skriva inn ein beskrivande tekst, slik at det er enklare å finna ut kva som var årsaka til at programmet krasja. Trykk så på Send." #: error_report.xhp msgctxt "" "error_report.xhp\n" "par_id3149670\n" "11\n" "help.text" msgid "You will not get an answer to your error report. If you need support, please visit the support forum on the Internet." msgstr "Du får ikkje svar på feilrapporten. Viss du treng støtte, bør du heller sjå innom støtteforumet vårt på Internett." #: error_report.xhp msgctxt "" "error_report.xhp\n" "par_id3153526\n" "12\n" "help.text" msgid "You may choose to respond to questions that the developers may have about the reported error. Mark the check box if you allow to be contacted by e-mail, should additional information be required. By default this box is not marked, so you will not get any e-mail." msgstr "Du kan velja om du vil svara på eventuelle spørsmål frå utviklarane om feilen du skriv om i rapporten. Merk av i avkryssingsboksen viss vil la oss kontakta deg viss vi treng meir informasjon om feilen." #: error_report.xhp msgctxt "" "error_report.xhp\n" "hd_id3150792\n" "13\n" "help.text" msgid "What Data is Sent?" msgstr "Kva data vert sendt?" #: error_report.xhp msgctxt "" "error_report.xhp\n" "par_id3154366\n" "14\n" "help.text" msgid "The error report consists of several files. The main file contains information about the error type, operating system name and version, memory usage, and the description that you entered. You can click the Show Report button on the main dialog of the Error Report Tool to view what will get sent in the main file." msgstr "Feilrapporten inneheld fleire filer. Hovudfila inneheld informasjon om feilen som har oppstått, operativsystem og versjon, minnebruk og beskrivinga di. Trykk på knappen Vis rapport i hovuddialogvindauget til feilrapporteringsverktøyet for å sjå på det som vert sendt i hovudfia." #: error_report.xhp msgctxt "" "error_report.xhp\n" "par_id3151177\n" "15\n" "help.text" msgid "In addition, relevant memory contents and stack traces are gathered by some system standard tools (\"dbhhelp.dll\" on Windows systems, \"pstack\" on UNIX systems). This information will be sent also." msgstr "Dessutan vil nokre standardverktøy i systemet («dbhhelp.dll» i Windows, «pstack» i UNIX) samla inn relevant innhald frå minnet og stakkspor. Denne informasjonen vert også sendt." #: export_ms.xhp msgctxt "" "export_ms.xhp\n" "tit\n" "help.text" msgid "Saving Documents in Other Formats" msgstr "Lagra dokument i andre format" #: export_ms.xhp msgctxt "" "export_ms.xhp\n" "bm_id3159233\n" "help.text" msgid "documents; saving in other formatssaving; documents in other formatsfiles; saving in other formatstext documents;saving in other formatsspreadsheets; saving in other formatsdrawings; saving in other formatspresentations; saving in other formatsexporting; to Microsoft Office formatsWord documents; saving asExcel; saving asPowerPoint export" msgstr "dokument; lagra i andre formatlagra; dokument i andre formatfiler; lagra i andre formattekstdokument; lagra i andre formatarekneark; lagra i andre formatteikningar; lagra i andre formatpresentasjonar; lagra i andre formateksportera; til Microsoft Office-formatWord-dokument; lagra somExcel; lagra someksportera til PowerPoint" #: export_ms.xhp msgctxt "" "export_ms.xhp\n" "hd_id3149416\n" "6\n" "help.text" msgid "Saving Documents in Other Formats" msgstr "Lagra dokumenta i andre format" #: export_ms.xhp msgctxt "" "export_ms.xhp\n" "par_id3150084\n" "2\n" "help.text" msgid "Choose File - Save as. You will see the Save as dialog." msgstr "Vel Fil → Lagra som. Dialogvindauget Lagra som vert opna." #: export_ms.xhp msgctxt "" "export_ms.xhp\n" "par_id3153348\n" "3\n" "help.text" msgid "In the Save as type or File type list box, select the desired format." msgstr "Vel det ønskte formatet i listeboksen Lagra som type eller Filtype." #: export_ms.xhp msgctxt "" "export_ms.xhp\n" "par_id3150985\n" "4\n" "help.text" msgid "Enter a name in the File name box and click Save." msgstr "Skriv inn eit namn i Filnamn og trykk på Lagra." #: export_ms.xhp msgctxt "" "export_ms.xhp\n" "par_id3153252\n" "7\n" "help.text" msgid "If you want the file dialogs to offer another file format as default, select that format in %PRODUCTNAME - PreferencesTools - Options - Load/Save - General in the Default file format area." msgstr "Viss du vil at eit anna filformat skal visast i dialogvindauget som standard, vel formatet i %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → Last inn/lagra → Generelt i området Standard filformat og ODF-innstillingar." #: export_ms.xhp msgctxt "" "export_ms.xhp\n" "par_id3149669\n" "5\n" "help.text" msgid "Save As" msgstr "Ark" #: fax.xhp msgctxt "" "fax.xhp\n" "tit\n" "help.text" msgid "Sending Faxes and Configuring $[officename] for Faxing" msgstr "Senda faksar og setja opp $[officename] for faksing" #: fax.xhp msgctxt "" "fax.xhp\n" "bm_id3156426\n" "help.text" msgid "faxes; sendingfaxes;configuring $[officename]sending; documents as faxes configuring;fax icon" msgstr "faksar; sendafaksar;setja opp $[officename]senda; dokument som faks setja opp;faksknapp" #: fax.xhp msgctxt "" "fax.xhp\n" "hd_id3156426\n" "5\n" "help.text" msgid "Sending Faxes and Configuring $[officename] for Faxing" msgstr "Senda faksar og setja opp $[officename] for faksing" #: fax.xhp msgctxt "" "fax.xhp\n" "par_id3156410\n" "3\n" "help.text" msgid "To send a fax directly from $[officename], you need a fax modem and a fax driver that allows applications to communicate with the fax modem." msgstr "Viss du vil senda faksar direkte frå $[officename], treng du eit faksmodem og ein faksdrivar som lar program kommunisere med faksmodemet." #: fax.xhp msgctxt "" "fax.xhp\n" "hd_id3166410\n" "6\n" "help.text" msgid "Sending a Fax Through the Print Dialog" msgstr "Sende ein faks via dialogvindauget «Skriv ut»" #: fax.xhp msgctxt "" "fax.xhp\n" "par_id3152996\n" "7\n" "help.text" msgid "Open the Print dialog by choosing File - Print and select the fax driver in the Name list box." msgstr "Opna dialogvindauget Skriv ut ved å velja Fil → Skriv ut, og vel faksdrivaren i lista Namn." #: fax.xhp msgctxt "" "fax.xhp\n" "par_id3155135\n" "8\n" "help.text" msgid "Clicking OK opens the dialog for your fax driver, where you can select the fax recipient." msgstr "Trykk på OK for å opna dialogvindauget for faksdrivaren. Her kan du velja mottakar for faksen." #: fax.xhp msgctxt "" "fax.xhp\n" "hd_id3153825\n" "9\n" "help.text" msgid "Configuring $[officename] a Fax Icon" msgstr "Setja opp faksknapp i $[officename]" #: fax.xhp msgctxt "" "fax.xhp\n" "par_id3153822\n" "10\n" "help.text" msgid "You can configure $[officename] so that a single click on an icon automatically sends the current document as a fax:" msgstr "Du kan setja opp $[officename] slik at det gjeldande dokumentet automatisk vert send som ein faks når du trykkjer på ein knapp:" #: fax.xhp msgctxt "" "fax.xhp\n" "par_id3145315\n" "11\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME Writer - Print." msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Vis" #: fax.xhp msgctxt "" "fax.xhp\n" "par_id3150985\n" "12\n" "help.text" msgid "Select the fax driver from the Fax list box and click OK." msgstr "Vel faksdrivaren i listeboksen Faks og trykk på OK." #: fax.xhp msgctxt "" "fax.xhp\n" "par_idN106EB\n" "help.text" msgid "Click the arrow icon at the end of the Standard bar. In the drop-down menu, choose Customize." msgstr "Trykk på pilknappen ved enden av standardverktøylinja og vel Tilpass verktøylinja i menyen." #: fax.xhp msgctxt "" "fax.xhp\n" "par_idN106F6\n" "help.text" msgid "The Toolbars tab page of the Customize dialog appears." msgstr "Fana Verktøylinjer i dialogvindauget Tilpass kjem fram." #: fax.xhp msgctxt "" "fax.xhp\n" "par_idN106FA\n" "help.text" msgid "Click Add Commands." msgstr "Klikk på Legg til kommandoar." #: fax.xhp msgctxt "" "fax.xhp\n" "par_idN10702\n" "help.text" msgid "Select the \"Documents\" category, then select the \"Send Default Fax\" command." msgstr "Merk kategorien «Dokument» og vel deretter «Send standardfaks»." #: fax.xhp msgctxt "" "fax.xhp\n" "par_idN10706\n" "help.text" msgid "Click Add and then Close." msgstr "Trykk på Legg til og deretter på Lukk." #: fax.xhp msgctxt "" "fax.xhp\n" "par_idN10712\n" "help.text" msgid "On the Toolbars tab page, click the down arrow button to position the new icon where you want it. Click OK." msgstr "Klikk på «Pil ned» på fana Verktøylinjer for å plassera den nye knappen der du vil ha han. Trykk på OK." #: fax.xhp msgctxt "" "fax.xhp\n" "par_idN10715\n" "help.text" msgid "Your Standard bar now has a new icon to send the current document as a fax." msgstr "standard-verktøylinja har nå ein ny knapp som kan brukast til å senda det gjeldande dokumentet som ein faks." #: filternavigator.xhp msgctxt "" "filternavigator.xhp\n" "tit\n" "help.text" msgid "Using the Filter Navigator" msgstr "Bruka Filterstruktur" #: filternavigator.xhp msgctxt "" "filternavigator.xhp\n" "bm_id3150322\n" "help.text" msgid "filters; Navigatorfilter conditions;connecting" msgstr "filter; navigatorfiltreringsvilkår;knyta saman" #: filternavigator.xhp msgctxt "" "filternavigator.xhp\n" "par_idN105A3\n" "help.text" msgid "Using the Filter Navigator" msgstr "Bruka filterstruktur" #: filternavigator.xhp msgctxt "" "filternavigator.xhp\n" "par_id3150322\n" "13\n" "help.text" msgid "To connect several filter conditions with Boolean OR, click the Filter navigation icon on the filter bar. The Filter navigator window appears." msgstr "Trykk på knappen for filternavigering på filterlinja dersom du vil knyta saman fleire filtreringsvilkår med ELLER. Då kjem vindauget Filternavigering fram." #: filternavigator.xhp msgctxt "" "filternavigator.xhp\n" "par_id3153711\n" "14\n" "help.text" msgid "The filter conditions that have been set appear in the Filter navigator. As soon as a filter is set, you see a blank filter entry at the bottom of the Filter navigator . You can select this entry by clicking the word \"Or\". Once you have selected the blank filter entry, you can enter additional filter conditions in the form. These conditions are linked by Boolean OR to the previously defined conditions." msgstr "Dei filtreringsvilkåra som er sette vert viste i filterstruktur. Når eit filter er gjeve, vil du sjå ei tom filteroppføring nedst i filterstruktur. Du kan velja denne oppføringa ved å trykka på ordet «Eller». Når du har vald ei tom filteroppføring, kan du skriva inn fleire filtreringsvilkår i skjemaet. Vilkåra vert lenkja saman med dei tidlegare gjevne vilkåra med eit logisk ELLER." #: filternavigator.xhp msgctxt "" "filternavigator.xhp\n" "par_id3145620\n" "15\n" "help.text" msgid "The context menu can be called for each entry in the Filter navigator. You can edit the filter conditions in this area directly as text. If you wish to check if a field has content or no content, you can select the filter conditions \"empty\" (SQL:\"Is Null\") or \"not empty\" (SQL: \"Is not Null\"). It is also possible to delete the entry by using the context menu." msgstr "Sprettoppmenyen kan opnast for alle oppføringane i filterutforskaren. Du kan redigera filtreringsvilkåra direkte som tekst i dette området. Viss du vil undersøkja om eit felt har innhald eller ikkje, kan du velja filtreringsvilkåret «tom» (SQL:«Is Null») eller «ikkje tom» (SQL: «Is not Null»). Oppføringa kan også slettast via sprettoppmenyen." #: filternavigator.xhp msgctxt "" "filternavigator.xhp\n" "par_id3156374\n" "16\n" "help.text" msgid "You can move filter conditions in the Filter navigator by dragging and dropping, or use the keys CommandCtrl+Alt+Up Arrow or CommandCtrl+Alt+Down Arrow. To copy filter conditions, drag them while holding down the CommandCtrl key." msgstr "Du kan flytta filtreringsvilkåra Filterstruktur ved å bruka dra og slepp eller med tastane CmdCtrl + Alt + Pil opp eller CmdCtrl + Alt + Pil ned. Du kan kopiera filtreringsvilkår ved å dra dei medan du held inne CmdCtrl." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "tit\n" "help.text" msgid "Searching for Attributes" msgstr "Søkja etter eigenskapar" #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "bm_id5681020\n" "help.text" msgid "fonts;findingfont attributes;findingtext attributes;findingattributes; findingfinding; attributesresetting;Find & Replace mode" msgstr "skrifttypar; finnaskrifteigenskapar; finnateksteigenskapar; finnaeigenskapar; finnafinna; eigenskapartilbakestilla; søk og erstatt-modus" #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN10663\n" "help.text" msgid "Searching for Attributes" msgstr "Søkja etter eigenskapar" #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN10681\n" "help.text" msgid "You can search for text with attributes that are applied either by direct formatting or by styles. For example, if you search for the Font attribute, all instances of text that do not use the default font are found. All text that has a directly coded font attribute, and all text where a style switches the font attribute, are found." msgstr "Du kan søkja etter tekst med tilpassa attributt ved hjelp av direkte formatering eller stilar. Viss du for eksempel søkjer etter attributtet Skrift, vil du finna alle førekomstar av tekst som bruker ei anna skrift enn standardskrifttypen. All tekst som har ein direkte koda tekstattributt og all tekst der ein stil endrar skriftattributta vert funnen." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN10688\n" "help.text" msgid "If you want to find text with any font by name, click the Format button in the Find & Replace dialog of %PRODUCTNAME Writer." msgstr "Viss du vil søkja etter tekst med in namngjeve skrift, trykkjer du på Format i dialogvindauget Søk og byt ut i %PRODUCTNAME Writer." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN1069D\n" "help.text" msgid "After you select the attributes that you want to search for, the Search for Styles box in the Options area of the %PRODUCTNAME Writer Find & Replace dialog changes to Including Styles." msgstr "Etter at du har vald kva eigenskapar du vil søkja etter, endrar Søk etter stilar-boksen i området Val i %PRODUCTNAME Writer-dialogvindauget Søk og byt ut seg til Ta med stilar." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN106B0\n" "help.text" msgid "If you want to search for text in which attributes were set by using direct formatting and styles, select the Including Styles box." msgstr "Viss du vil søkja etter tekst med eigenskapar frå direkte formatering og stilar, må du kryssa av Ta med stilar." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN106B7\n" "help.text" msgid "The search criteria for attributes are listed below the Search for box." msgstr "Søkjekriterium for eigenskapar er lista under Søk etter-feltet." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN106BE\n" "help.text" msgid "To search for all font changes" msgstr "Søkja på alle skriftendringar" #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN106C5\n" "help.text" msgid "Choose Edit - Find & Replace." msgstr "Vel Rediger → Søk og byt ut." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN106CD\n" "help.text" msgid "Clear the Search for text box if necessary." msgstr "Tøm tekstboksen Søk om nødvendig." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN106D5\n" "help.text" msgid "Click Attributes." msgstr "Trykk på Eigenskapar." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN106DD\n" "help.text" msgid "In the Attributes dialog, select the Font check box, and click OK." msgstr "Merk av for boksenSkrift i dialogvindauget Eigenskapar og trykk på OK." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN106E8\n" "help.text" msgid "In the Find & Replace dialog, you now can read \"Font\" below the Search for text box." msgstr "I dialogvindauget Søk og byt ut vil du sjå at «Skrift» kjem fram under tekstfeltet Søk etter." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN106F4\n" "help.text" msgid "Click Find." msgstr "Trykk OK." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN106FB\n" "help.text" msgid "All places where a font change was applied, either directly or by assigning an appropriate style, are found." msgstr "Alle stadene der ei skriftendring er brukt, anten direkte eller ved hjelp av ein stil, vert nå funne." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN106FE\n" "help.text" msgid "To reset the Find & Replace mode" msgstr "Tilbakestilla «Søk og byt ut»-tilstanden." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN10702\n" "help.text" msgid "To stop searching for the current attributes, reset the Find & Replace dialog to normal mode." msgstr "Viss du vil slutta å bruka søk etter dei gjeldande eigenskapane, kan du stilla dialogvindauget Søk og byt ut tilbake til normal tilstand." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN1070C\n" "help.text" msgid "Click No Format." msgstr "Trykk på Uformatert." #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_idN1071E\n" "help.text" msgid "Find & Replace dialog" msgstr "Dialogvindauget Søk og byt ut" #: find_attributes.xhp msgctxt "" "find_attributes.xhp\n" "par_id6837672\n" "help.text" msgid "Searching for attributes is available in the Find & Replace dialog for text documents." msgstr "Søk etter eigenskapar i tekstdokumenter er tilgjengeleg i dialogvindauget «Søk og byt ut»." #: flat_icons.xhp msgctxt "" "flat_icons.xhp\n" "tit\n" "help.text" msgid "Changing Icon Views" msgstr "Endra ikonvisingar" #: flat_icons.xhp msgctxt "" "flat_icons.xhp\n" "bm_id3145669\n" "help.text" msgid "buttons; big/smallviews; iconsicon sizeschanging;icon sizeslarge iconssmall icons" msgstr "ikon; store/småvisingar; ikonikonstorleikarendra;ikonstorleikarstore ikonsmå ikon" #: flat_icons.xhp msgctxt "" "flat_icons.xhp\n" "hd_id3145669\n" "3\n" "help.text" msgid "Changing Icon Size" msgstr "Endra ikonstorleik" #: flat_icons.xhp msgctxt "" "flat_icons.xhp\n" "par_id3155535\n" "4\n" "help.text" msgid "You can change the icon view between small and large icons." msgstr "Du kan byta mellom å visa små eller store ikon." #: flat_icons.xhp msgctxt "" "flat_icons.xhp\n" "par_id3153748\n" "5\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - $[officename]." msgstr "Vis Verktøy → Innstillingar → $[officename]." #: flat_icons.xhp msgctxt "" "flat_icons.xhp\n" "par_id3163802\n" "6\n" "help.text" msgid "On the View tab page, select the Toolbar icon size." msgstr "Vel Verktøyikon-ststorleik på fana Vis." #: flat_icons.xhp msgctxt "" "flat_icons.xhp\n" "par_id3157909\n" "7\n" "help.text" msgid "Click OK." msgstr "Trykk OK." #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "tit\n" "help.text" msgid "Using Toolbars" msgstr "Bruka verktøylinjer" #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "bm_id3152801\n" "help.text" msgid "toolbars;docking/undockingtoolbars;viewing/closingclosing;toolbarsdocking;toolbarsfixing toolbarsdetaching toolbarsplacing toolbarspositioning;toolbarsmoving;toolbarsattaching toolbarsfloating toolbarswindows;dockingviewing;toolbarsshowing;toolbarsicon bars, see toolbarsbutton bars, see toolbars" msgstr "verktøylinjer;festa/losnaverktøylinjer;vising/lukkinglukking;verktøylinjerfesting;verktøylinjerreparere verktøylinjerlosna verktøylinjerplassera verktøylinjerposisjonering;verktøylinjerflytta;verktøylinjerfesta verktøylinjerflytande verktøylinjervindauge;festa sjå på;verktøylinjervisa;verktøylinjerikonmenylinjer, sjå verktøylinjerknappmenylinje, sjå verktøylinjer" #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "hd_id3152801\n" "9\n" "help.text" msgid "Using Toolbars" msgstr "Bruka verktøylinjer" #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_id3143267\n" "7\n" "help.text" msgid "Some toolbar icons, for example the Font Color icon, can open another toolbar. Click the arrow next to the icon to open a toolbar containing further icons." msgstr "Nokre knappar på verktøylinja, for eksempel knappen Skriftfarge, kan opna ei anna verktøylinje. Trykk på pila ved sida av knappen for å opna ei verktøylinje som inneheld fleire knappar." #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_id3155450\n" "8\n" "help.text" msgid "You now have a choice: either click the icon that you want to activate, or seize the toolbar by its title bar and drag it while holding down the mouse button." msgstr "Du kan nå velja anten å klikka på knappen du vil slå på, eller ta tak i tittellinja på verktøylinja og dra medan du held nede museknappen." #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "hd_id733970\n" "help.text" msgid "Context of Toolbars" msgstr "Verktøylinjer i samanheng" #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_id341196\n" "help.text" msgid "Some toolbars open automatically depending on the context. For example, when you click inside a table in a text document, the Table toolbar opens. When you click inside a numbered paragraph, the Bullets and Numbering toolbar opens." msgstr "Nokre verktøylinjer vert opna automatisk, avhengig av samanhengen. Når du for eksempel plasserer musepeikaren i ein tabell i eit tekstdokument, vert verktøylinja «Tabell» opna. Når du plasserer musepeikaren i eit nummerert avsnitt, vert verktøylinja «Punkt og nummerering» opna." #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "hd_id4224372\n" "help.text" msgid "To Close a Toolbar Temporarily" msgstr "Mellombels lukking av ei verktøylinje" #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_id295724\n" "help.text" msgid "Click the icon in the toolbar's title bar, or choose Close Toolbar from the context menu. The toolbar will be shown automatically again when the context becomes active again." msgstr "Trykk på ikonet i tittellinja til verktøylinja eller vel Lukk verktøylinja i sprettoppmenyen. Verktøylinja vert automatisk vist på nytt neste gong den same samanhangen vert aktivert igjen." #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "hd_id1905575\n" "help.text" msgid "To Close a Toolbar Permanently" msgstr "Lukka e verktøylinje permanent" #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_id9776909\n" "help.text" msgid "While the toolbar is visible, choose View - Toolbars and click the name of the toolbar to remove the check mark." msgstr "Når verktøylinja er synleg, vel Vis → Verktøylinjer og klikk på namnet til verktøylinja for å fjerna markeringa for denne." #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_idN1077E\n" "help.text" msgid "To Show a Closed Toolbar" msgstr "Visa ei lukka verktøylinje" #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_idN10785\n" "help.text" msgid "Choose View - Toolbars and click the name of the toolbar." msgstr "Vel Vis → Verktøylinjer og trykk på namnet til verktøylinja." #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_id7296975\n" "help.text" msgid "Choose View - Toolbars - Reset to reset the toolbars to their default context sensitive behavior. Now some toolbars will be shown automatically, dependent on the context." msgstr "Vel Vis → Verktøylinjer → Tilbakestill for å stilla verktøylinjene tilbake til standardoppførsel. Nokre av verktøylinjene vert nå viste automatisk, avhengig av samanhangen." #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_idN106E9\n" "help.text" msgid "To Make a Toolbar a Floating Toolbar" msgstr "Gjera ei verktøylinje til ei flytande verktøylinje" #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_idN106EF\n" "help.text" msgid "Click the handle at the start of the toolbar, and drag the toolbar into the document." msgstr "Trykk på handtaket på enden av verktøylinja og dra verktøylinja inn i dokumentet." #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_idN106F2\n" "help.text" msgid "To Reattach a Floating Toolbar" msgstr "Slik festar du ei flytande verktøylinje" #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_idN106F7\n" "help.text" msgid "Drag the title bar of the toolbar to an edge of the document window." msgstr "Trykk på tittellinja på verktøylinja og dra verktøylinja til kanten av dokumentvindauget." #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_id6154362\n" "help.text" msgid "To reattach a floating window, drag-and-drop the window's title bar to an edge of the document window. The mouse pointer should be very close to the document window's edge when you release the mouse button." msgstr "For å festa eit flytande vindauge, dra og slepp tittellinja for vindauget til kanten på eit dokumentvindauge. Peikaren må vera svært nære kanten på dokumentvindauget når du slepper knappen." #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_id1510055\n" "help.text" msgid "Depending on your system's window manager settings, you may also double-click an empty place on the toolbar or window, while holding down the CommandCtrl key. Or double-click the title bar of the floating toolbar or window." msgstr "Avhengig av korleis handteringa av systemvindauge er sett opp, kan du kanskje også dobbeltklikka på ein ledig plass på verktøylinja eller i eit vindauge medan du held nede tasten CmdCtrl. Eller dobbeltklikka på tittellinja til den flytande verktøylinja eller det flytande vindauget." #: floating_toolbar.xhp msgctxt "" "floating_toolbar.xhp\n" "par_idN107AC\n" "help.text" msgid "Docking toolbars and windows by drag-and-drop depends on your system's window manager settings. You must enable your system to show the full window contents when you move a window, instead of showing just the outer frame." msgstr "Å festa verktøylinjer og vindauge ved å bruka dra og slepp er avhengig av kva innstillingar systemet er sett opp med for vindaugehandtering. Du må sjå etter at systemet viser innhaldet i vindauget under flytting, i staden for berre å visa den ytre ramma." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "tit\n" "help.text" msgid "Fontwork For Graphical Text Art" msgstr "Fontwork for grafisk tekstkunst" #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "bm_id3696707\n" "help.text" msgid "graphical text art designing; fonts TextArt, see Fontwork WordArt, see Fontwork Fontwork text effects effects; Fontwork icons text; Fontwork icons 3D text creation rotating;3D text editing;Fontwork objects inserting;Fontwork objects" msgstr "grafisk tekstkunst utforming; skrifttypar TextArt, sjå Fontwork WordArt, sjå Fontwork Fontwork teksteffektar effektar; Fontwork icons tekst; Fontwork ikon laga 3D-tekst rotera;3D-tekst redigera;Fontwork-objekt setja inn;Fontwork-objekt" #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN1066D\n" "help.text" msgid "Fontwork For Graphical Text Art" msgstr "Fontwork til grafisk tekstkunst " #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN1068B\n" "help.text" msgid "You can use Fontwork to create graphical text art objects." msgstr "Du kan bruka Fontwork for å laga grafiske tekstkunstobjekt." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN10691\n" "help.text" msgid "To create a Fontwork object" msgstr "Slik lagar du eit Fontwork-objekt" #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_id0202200911373965\n" "help.text" msgid "If you don't see the Drawing toolbar or the Fontwork toolbar, choose View - Toolbars to enable the toolbar." msgstr "Viss du ikkje ser verktøylinjene for teikning eller skriftforming, bruk Vis → Verktøylinjer for å slå dei på." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN1069C\n" "help.text" msgid "On the Drawing toolbar or on the Fontwork toolbar, click the Fontwork Gallery icon.Icon" msgstr "Klikk på ikonet Fontwork-galleri Ikon på verktøylinja teikning eller på verktøylinja Fontwork. " #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_id3149761\n" "55\n" "help.text" msgid "Select a Fontwork style and click OK to insert the Fontwork into your document. Double-click or Ctrl+double-click the Fontwork in your document to enter text edit mode and change the text." msgstr "Vel ein Fontwork-stil og trykk på «OK» for å setja Fontwork inn i dokumentet. Dobbeltklikk eller eventuelt hald nede Ctrl medan du dobbeltklikkar på Fontwork-teksten i dokumentet for å gå inn i redigeringstilstand slik at du kan endra teksten." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN106A0\n" "help.text" msgid "In the Fontwork Gallery dialog, select a Fontwork style and click OK." msgstr "Merk ein skriftformingsstil i dialogvindauget Skriftformingsgalleri og trykk «OK»." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN10755\n" "help.text" msgid "The Fontwork object is inserted into your document. Fontwork objects are Custom Shapes. Using the 3D Settings toolbar, you can switch the view at any time from 2D to 3D and back." msgstr "Fontwork-objektet vert sett inn i dokumentet. Fontwork-objekt er tilpassa former. Ved å bruka verktøylinja for 3D-innstillingar, kan du byta visinga mellom 2D og 3D." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN106A4\n" "help.text" msgid "Double-click the object to enter text edit mode." msgstr "Dobbeltklikk på objektet for å gå til tekstredigeringstilstand." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN107D5\n" "help.text" msgid "Replace the default Fontwork text with your own text." msgstr "Byt ut Fontwork-teksten med din eigen tekst." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN106A8\n" "help.text" msgid "Press Esc to exit text edit mode." msgstr "Trykk Escape for å gå ut av tekstredigeringstilstand." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN106AE\n" "help.text" msgid "To edit a Fontwork object" msgstr "Slik redigerer du eit Fontwork-objekt" #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN106B5\n" "help.text" msgid "Click the Fontwork object. If the Fontwork object is inserted in the background, hold down the Ctrl key while you click." msgstr "Klikk på Fontwork-objektet. Viss Fontwork-objektet er sett inn i bakgrunnen, hald nede Ctrl medan du klikkar." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN106B8\n" "help.text" msgid "The Fontwork toolbar is displayed. If you do not see the Fontwork toolbar, choose View - Toolbars - Fontwork." msgstr " Verktøylinja Skriftforming vert vist. Viss du ikkje ser verktøylinja, vel Vis → Verktøylinjer → Skriftforming." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN106BC\n" "help.text" msgid "Click an icon in the Fontwork toolbar." msgstr "Trykk på ein knapp i verktøylinja Skriftforming." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN10839\n" "help.text" msgid "The following icons are available:" msgstr "Desse knappane er tilgjengelege:" #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN106C5\n" "help.text" msgid "Fontwork Gallery - adds another Fontwork object" msgstr "Fontwork-galleri - legg til eit nytt Fontwork-objekt" #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN106C9\n" "help.text" msgid "Fontwork Shape - edits the shape" msgstr "Fontwork-form - redigerar forma" #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN106CD\n" "help.text" msgid "Fontwork Same Letter Heights - changes the height of characters" msgstr "Fontwork, lik bokstavhøgd - endrar høgda på teikna" #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN106D5\n" "help.text" msgid "Fontwork Alignment - aligns the text" msgstr "Fontwork, justering - justerer teksten" #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN106D9\n" "help.text" msgid "Fontwork Character Spacing - changes the character spacing and kerning" msgstr "Fontwork, teiknavstand - endrar avstanden mellom teikn og kerning" #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN108CA\n" "help.text" msgid "To edit more Fontwork attributes" msgstr "Slik redigerer du fleire eigenskapar i Fontwork" #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN108D1\n" "help.text" msgid "Click the Fontwork object. If the Fontwork object is inserted in the background, hold down the Ctrl key while you click." msgstr "Klikk på Fontwork-objektet. Viss Fontwork-objektet er sett inn i bakgrunnen, hald nede Ctrl medan du klikkar." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN108D5\n" "help.text" msgid "Select the properties from the Drawing Object Properties toolbar. You can change the line width, line color, fill color, fill style, and more." msgstr "Vel dei eigenskapane du vil bruka frå verktøylinja Eigenskapar for teikneobjekt. Du kan endra linjebreidda, linjefargen, områdestil, fyll m.m." #: fontwork.xhp msgctxt "" "fontwork.xhp\n" "par_idN108E7\n" "help.text" msgid "Fontwork toolbar" msgstr "Verktøylinje for skriftforming" #: formfields.xhp msgctxt "" "formfields.xhp\n" "tit\n" "help.text" msgid "Inserting and Editing Buttons" msgstr "Setja inn og redigera knappar" #: formfields.xhp msgctxt "" "formfields.xhp\n" "bm_id3149798\n" "help.text" msgid "command buttons, see push buttons controls;adding to documents inserting;push buttons keys;adding push buttons buttons;adding push buttons press buttons, see push buttons push buttons;adding to documents" msgstr "kommandoknappar kontrollar;leggja til i dokument setja inn;kommandoknappar tastar;leggja til kommandoknappar knappar;leggja til kommandoknappar trykknappar, sjå kommandoknappar kommandoknappar;leggja til i dokument" #: formfields.xhp msgctxt "" "formfields.xhp\n" "hd_id3149798\n" "5\n" "help.text" msgid "Adding a Command Button to a Document" msgstr "Leggja ein kommandoknapp til i eit dokument" #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_idN10731\n" "help.text" msgid "You can use the Form Controls toolbar to add checkboxes, buttons, tables showing data records, and other controls to a document." msgstr "Du kan bruka verktøylinja Kontrollelement for skjema til å leggja til avkryssingsboksar, knappar, tabellar som viser datapostar, og andre kontrollelement i eit dokument." #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_idN1077F\n" "help.text" msgid "To Add a Button to a Document" msgstr "Leggja til ein knapp i eit dokument" #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_id3154751\n" "6\n" "help.text" msgid "Choose View - Toolbars - Form Controls." msgstr "Vel Vis → Verktøylinjer → Kontrollelement for skjema." #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_id3145345\n" "7\n" "help.text" msgid "On the Form Controls toolbar, click the Push Button icon." msgstr "På verktøylinja Kontrollelement for skjema trykker du på Trykknapp." #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_idN107A4\n" "help.text" msgid "The mouse pointer changes to a cross-hair." msgstr "Musemarkøren endrar seg til eit trådkors." #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_id3159233\n" "8\n" "help.text" msgid "In the document, drag to draw the button." msgstr "I dokumentet dreg du for å teikna knappen." #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_idN107B2\n" "help.text" msgid "Right-click the button and choose Control." msgstr "Høgreklikk på knappen og vel Kontrollelement." #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_idN107CD\n" "help.text" msgid "Specify the properties of the button." msgstr "Vel eigenskapane for knappen." #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_id3154923\n" "11\n" "help.text" msgid "To change the button label, click the General tab, and edit the text in the Label box." msgstr "Viss du vil endre teksten på knappen, kan du trykkja på fana Generelt og redigera teksten i feltet Etikett." #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_id3147303\n" "12\n" "help.text" msgid "To attach a macro to the button, click the Events tab, and click the ... button beside the button action that you want to run the macro. In the Assign Macro dialog, locate the macro that you want to use, and then click OK." msgstr "Viss du vil knyta ein makro til knappen, kan du gå til fana Hendingar og trykkja på ...-knappen ved sida av handlinga du vil at makroen skal utføra. Finn makroen du vil bruka i dialogvindauget Tildel makro og trykk OK." #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_idN10814\n" "help.text" msgid "Close the Properties dialog." msgstr "Lukk dialogvindauget Eigenskapar." #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_id3147350\n" "76\n" "help.text" msgid "(Optional) Specify the properties of the form that the button belongs to." msgstr "(Valfri) Angje eigenskapane til skjemaet som knappen høyrer til." #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_idN10828\n" "help.text" msgid "Right-click the button and choose Form." msgstr "Høgreklikk på knappen og vel Skjema." #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_idN1082F\n" "help.text" msgid "The Form Properties dialog opens." msgstr "Dialogvindauget Skjemaeigenskapar vert opna." #: formfields.xhp msgctxt "" "formfields.xhp\n" "par_idN10837\n" "help.text" msgid "Specify the properties for the form and then close the dialog." msgstr "Bestem eigenskapane for skjemaet og lukk dialogvindauget." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "tit\n" "help.text" msgid "Inserting Objects From the Gallery" msgstr "Setja inn objekt frå galleriet" #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "bm_id3145136\n" "help.text" msgid "Gallery; inserting pictures frompictures; inserting from Galleryobjects; inserting from Gallerypatterns for objectstextures;inserting from Gallerybackgrounds;inserting from Galleryinserting;objects from Gallerycopying;from Gallery" msgstr "galleri; setja inn bilete fråbilete; setja inn frå gallerietobjekt; setja inn frå gallerietmønster for objektteksturar;setja inn frå gallerietbakgrunnar;setja inn frå gallerietsetja inn;objekt frå gallerietkopiera;frå galleriet" #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "hd_id3145136\n" "1\n" "help.text" msgid "Inserting Objects From the Gallery " msgstr "Setja inn objekt frå galleriet " #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3145345\n" "2\n" "help.text" msgid "You can insert an object in a document either as a copy or as a link. A copy of an object is independent of the original object. Changes to the original object have no effect on the copy. A link remains dependent on the original object. Changes to the original object are also reflected in the link." msgstr "Du kan setja inn eit objekt i eit dokument anten som ein kopi eller som ei lenkje. Ein kopi av eit objekt er uavhengig av det opphavlege objektet. Endringar i det opphavlege objektet påverkar ikkje kopien. Ei lenkje er alltid avhengig av det opphavlege objektet. Endringar i det opphavlege objektet vert også viste på kopien." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "hd_id3145313\n" "3\n" "help.text" msgid "Inserting an object as a copy" msgstr "Setja inn eit objekt som ein kopi" #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3145382\n" "4\n" "help.text" msgid "Open the Gallery by clicking the Gallery icon on the Standard bar, or by selecting Tools - Gallery." msgstr "Opna galleriet ved å trykkja på Galleristandardverktøylinja eller ved å velja Verktøy → Galleri." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3154306\n" "5\n" "help.text" msgid "Select a theme." msgstr "Vel eit tema." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3154516\n" "6\n" "help.text" msgid "Select an object using a single click." msgstr "Vel eit objekt ved å trykkja på det éi gong." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3153561\n" "7\n" "help.text" msgid "Drag the object into the document, or right-click to open the context menu and select Insert and Copy." msgstr "Dra objektet inn i dokumentet eller høgreklikk på det for å opna sprettoppmenyen og vel Set inn og Kopiar." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "hd_id3153061\n" "8\n" "help.text" msgid "Inserting an object as a link" msgstr "Setja inn eit objekt som ei lenkje" #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3145068\n" "9\n" "help.text" msgid "Open the Gallery by clicking the Gallery icon on the Standard bar, or by selecting Tools - Gallery." msgstr "Opna galleriet ved å trykkja på Galleristandardverktøylinja eller ved å velja Verktøy → Galleri." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3148663\n" "10\n" "help.text" msgid "Select a theme." msgstr "Vel eit tema." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3150543\n" "11\n" "help.text" msgid "Select an object by a single click." msgstr "Vel eit objekt ved å trykkja på det éi gong." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3154140\n" "12\n" "help.text" msgid "Drag the object into the document while pressing the Shift and CommandCtrl keys, or right-click to open the context menu and select Insert and Link." msgstr "Dra objektet inn i dokumentet medan du held nede tastane Shift og CmdCtrl, eller høgreklikk for å opna sprettoppmenyen og vel der Set inn og Lenkje." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "hd_id3156282\n" "13\n" "help.text" msgid "Inserting an object as a background graphic" msgstr "Setja inn eit objekt som eit bakgrunnsbilete" #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3152920\n" "14\n" "help.text" msgid "Open the Gallery by clicking the Gallery icon on the Standard bar, or by selecting Tools - Gallery." msgstr "Opna galleriet ved å trykkja på Galleristandardverktøylinja eller ved å velja Verktøy → Galleri." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3151041\n" "15\n" "help.text" msgid "Select a theme." msgstr "Vel eit tema." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3145607\n" "16\n" "help.text" msgid "Select an object by a single click." msgstr "Merk eit objekt ved å trykka éin gong på det." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3147289\n" "17\n" "help.text" msgid "Open the context menu and choose Insert - Background - Page or Paragraph." msgstr "Opna sprettoppmenyen og vel Set inn → Bakgrunn → Side eller Avsnitt." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "hd_id3145787\n" "18\n" "help.text" msgid "Inserting an object as a texture (pattern) for another object" msgstr "Setja inn eit objekt som ein tekstur (eit mønster) for eit anna objekt" #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3159196\n" "19\n" "help.text" msgid "Open the Gallery by clicking the Gallery icon on the Standard bar, or by selecting Tools - Gallery." msgstr "Opna galleriet ved å trykkja på Galleristandardverktøylinja eller ved å velja Verktøy → Galleri. " #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3152596\n" "20\n" "help.text" msgid "Select a theme." msgstr "Vel eit tema." #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3148617\n" "21\n" "help.text" msgid "Select an object by a single click." msgstr "Merk eit objekt ved å trykka éin gong på det. " #: gallery_insert.xhp msgctxt "" "gallery_insert.xhp\n" "par_id3147443\n" "22\n" "help.text" msgid "Drag the object on to the other object in the document while pressing CommandCtrl." msgstr "Dra objektet oppå det andre objektet i dokumentet medan du held nede CmdCtrl." #: groups.xhp msgctxt "" "groups.xhp\n" "tit\n" "help.text" msgid "Working with Groups" msgstr "Arbeida med grupper" #: groups.xhp msgctxt "" "groups.xhp\n" "bm_id6888027\n" "help.text" msgid "groups;entering/exiting/ungroupingframes; selection framesselecting;objectsexiting;groupsentering groupsungrouping groupsselection framesmultiple selectionmarking, see selecting" msgstr "grupper;gå inn i/avslutta/løyse opp grupperammer; valrammervelja;objektavslutta;gruppergå inn i grupperløysa opp gruppervalrammerfleirvalmarkering, sjå val" #: groups.xhp msgctxt "" "groups.xhp\n" "hd_id2454298\n" "help.text" msgid "Working with Groups " msgstr "Arbeida med grupper " #: groups.xhp msgctxt "" "groups.xhp\n" "par_id2307199\n" "help.text" msgid "You can combine several graphic objects into a group so that you can use them like a single object." msgstr "Du kan kombinera fleire biletobjekt til ei gruppe, slik at du kan bruka dei som eitt enkelt objekt." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id9983825\n" "help.text" msgid "You can move, transform, resize, distort, or convert all objects in a group together, and you can enter the group any time to change the individual objects." msgstr "Du kan flytta, omforma, endra storleik på, forvrenga eller gjera om alle objektea i ei gruppe samstundes og du kan når som helst gå inn i gruppa for å endra dei enkelte objekta i gruppa." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id5734733\n" "help.text" msgid "You can change the properties (line size, fill color, and more) of all objects in a group together, and you can enter the group and change the individual objects." msgstr "Du kan endra eigenskapane (linjestorleik, fyllfarge og mykje meir) for alle objekta i ei gruppe samstundes og du kan når som helst gå inn i gruppa for å endra dei enkelte objekta i gruppa." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id561540\n" "help.text" msgid "Groups can also be nested to form groups within other groups." msgstr "Grupper kan også nøstast, slik at det vert laga grupper inne i andre grupper." #: groups.xhp msgctxt "" "groups.xhp\n" "hd_id7705618\n" "help.text" msgid "To group objects" msgstr "Gruppera objekt" #: groups.xhp msgctxt "" "groups.xhp\n" "par_id607013\n" "help.text" msgid "Select the objects together that you want to group. Hold down Shift while you click the individual objects." msgstr "Merk alle objekta som skal vera med i gruppa du vil laga. Hald nede Shift-tasten medan du trykkjer på dei enkelte objekta." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id1399578\n" "help.text" msgid "Right-click any of the selected objects to open the context menu. In Calc or Writer, commands are in a submenu Group, while in Impress or Draw, they are at the toplevel of the context menu." msgstr "Høgreklikk på eitt av objekta for å opna sprettoppmenyen. I Calc og Writer finn du kommandoane i undermenyen Grupper, medan du i Impress og Draw finn dei som eiga oppføring i menyen." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id598162\n" "help.text" msgid "Choose Group." msgstr "Vel Grupper." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id6738792\n" "help.text" msgid "To select the objects, you can also drag a selection frame around the objects." msgstr "Du kan også velja objekt ved å dra ei ramme rundt objekta." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id7309793\n" "help.text" msgid "For example, you can group all of the objects in a company logo to move and resize the logo as a single object." msgstr "Til dømes kan du gruppera alle objekta i ein firmalogo for å kunne flytta og forstørra logoen som eit enkeltobjekt." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id1227759\n" "help.text" msgid "After you have grouped objects, selecting any part of the group selects the entire group." msgstr "Etter at du har gruppert objekt, vil du velja heile gruppa dersom du vel éin del av ho." #: groups.xhp msgctxt "" "groups.xhp\n" "hd_id7424237\n" "help.text" msgid "To enter a group" msgstr "Gå inn i ei gruppe" #: groups.xhp msgctxt "" "groups.xhp\n" "par_id1388592\n" "help.text" msgid "Right-click any object of the group. In Calc or Writer, commands are in a submenu Group, while in Impress or Draw, they are at the toplevel of the context menu." msgstr "Høgreklikk på eit objekt i gruppa. I Calc og Writer er kommandoane i undermenyen Grupper, i Impress og Draw er dei øvst i sprettoppmenyen." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id343943\n" "help.text" msgid "Choose Enter Group." msgstr "Vel Rediger gruppe." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id8726767\n" "help.text" msgid "Now you can select and edit a single object in the group." msgstr "Nå kan du merka og redigera eitt enkelt objekt i gruppa." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id691549\n" "help.text" msgid "You can add or delete objects to and from a group in this mode." msgstr "I denne tilstanden kan du leggja til eller sletta objekt i ei gruppe." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id9909665\n" "help.text" msgid "The objects that are not part of the group are shown with dimmed colors." msgstr "I denne tilstanden kan du leggja til eller sletta objekt i ei gruppe." #: groups.xhp msgctxt "" "groups.xhp\n" "hd_id9141819\n" "help.text" msgid "To exit a group" msgstr "Gå ut av ei gruppe" #: groups.xhp msgctxt "" "groups.xhp\n" "par_id6354869\n" "help.text" msgid "Right-click any object of the group. In Calc or Writer, commands are in a submenu Group, while in Impress or Draw, they are at the toplevel of the context menu." msgstr "Høgreklikk på eit objekt i gruppa. I Calc og Writer er kommandoane i undermenyen Grupper, i Impress og Draw øvst i sprettoppmenyen." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id2685323\n" "help.text" msgid "Choose Exit Group." msgstr "Vel Gå ut av gruppe." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id6042664\n" "help.text" msgid "To exit a group in Draw or Impress, you can also double-click anywhere outside the group." msgstr "I Draw og Impress kan du også gå ut av ei gruppe ved å dobbeltklikka kvar som helst utanfor gruppa." #: groups.xhp msgctxt "" "groups.xhp\n" "hd_id7889950\n" "help.text" msgid "To ungroup a group" msgstr "Løysa opp ei gruppe" #: groups.xhp msgctxt "" "groups.xhp\n" "par_id3236182\n" "help.text" msgid "Right-click any object of the group. In Calc or Writer, commands are in a submenu Group, while in Impress or Draw, they are at the toplevel of the context menu." msgstr "Høgreklikk på eit objekt i gruppa. I Calc og Writer er kommandoane i undermenyen Grupper, i Impress og Draw øvst i sprettoppmenyen. " #: groups.xhp msgctxt "" "groups.xhp\n" "par_id1251258\n" "help.text" msgid "Choose Ungroup." msgstr "Vel Løys opp gruppe." #: groups.xhp msgctxt "" "groups.xhp\n" "par_id8111819\n" "help.text" msgid "Now you can select and edit all objects as individual objects." msgstr "Nå kan du velja og redigera alle objekta som enkeltobjekt." #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "tit\n" "help.text" msgid "Editing Hyperlinks" msgstr "Redigera hyperlenkjer" #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "bm_id3153910\n" "help.text" msgid "hyperlinks; editinglinks; editing hyperlinksediting; hyperlinkstext attributes; hyperlinksbuttons;editing hyperlink buttonsURL;changing hyperlink URLs" msgstr "hyperlenkjer; redigeringlenkjer; redigera hyperlenkjerredigering; hyperlenkjertekstattributt; hyperlenkjerknappar;redigera hyperlenkjeknapparURL;endra hyperlenkje-URL-ar" #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "hd_id3153910\n" "11\n" "help.text" msgid "Editing Hyperlinks" msgstr "Redigera hyperlenkjer" #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "par_id4124881\n" "help.text" msgid "When you CommandCtrl-click a hyperlink in a Writer document, your web browser opens with the requested web address. If you don't use a mouse, position the cursor inside the hyperlink and open the context menu by Shift+F10, then choose Open Hyperlink." msgstr "Når du held nede CmdCtrl og klikkar på ei hyperlenkje i eit Writer-dokument vert nettlesaren opna med den aktuelle nettadressa. Viss du ikkje brukar ei mus, plasser markøren inni hyperlenkja og opna sprettoppmenyen med Shift + F10 og vel «Opna hyperlenkje»." #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "hd_id3145071\n" "26\n" "help.text" msgid "Change the text of a hyperlink as follows" msgstr "Slik kan du endra teksten i ei hyperlenkje" #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "par_id3166410\n" "12\n" "help.text" msgid "In Writer documents, you can click anywhere into a hyperlink and edit the visible text." msgstr "I Writer-dokument kan du klikka kvar som helst i ei hyperlenkje og redigera den synlege teksten." #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "par_id2690511\n" "help.text" msgid "If you leave the hyperlink by positioning the cursor somewhere else, only the visible text will be changed." msgstr "Viss du går ut av hyperlenkja ved å plassere markøren utanfor lenkja, er det berre den synlege teksten som vert endra." #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "par_id1983092\n" "help.text" msgid "If you leave the hyperlink by entering a space character directly following the last character, the AutoCorrect - if enabled - will change the target URL to be the same as the visible text." msgstr "Viss du går ut av hyperlenkja ved å skriva inn eit mellomromsteikn rett etter det siste teiknet, vil autorettinga, viss denne funksjonen er slått på, endra mål-URL-til å verta den same som den synlege teksten." #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "par_id333262\n" "help.text" msgid "In all document types, you can open the Hyperlink dialog to edit a hyperlink. First set the cursor into the hyperlink or directly in front of the hyperlink, then click the Hyperlink icon on the Standard bar." msgstr "I alle dokumenttypane kan du opna dialogvindauget for hyperlenkjer for å redigera ei hyperlenkje. Først plasserer du markøren i eller rett framføre hyperlenkja og trykkjer deretter på knappen «Hyperlenkje» på standardverktøylinja" #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "hd_id3158432\n" "30\n" "help.text" msgid "Change the URL of a hyperlink as follows" msgstr "Slik forandrar du URL-en i ei hyperlenkje" #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "par_id3150503\n" "31\n" "help.text" msgid "As described above, open Hyperlink Dialog." msgstr "Opna dialogvindauget Hyperlenkje slik som forklart ovanfor." #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "hd_id3148686\n" "33\n" "help.text" msgid "Change the attribute of all hyperlinks" msgstr "Endra eigenskapane for alle hyperlenkjer" #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "par_id3148943\n" "25\n" "help.text" msgid "Open the Styles and Formatting window." msgstr "Opna vindauget for stilhandsamaren." #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "par_idN10826\n" "help.text" msgid "Click the Character Styles icon." msgstr "Trykk på ikonet for teiknstilar." #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "par_idN1082C\n" "help.text" msgid "Right-click the \"Internet Link\" or \"Visited Internet Link\" character style, and choose Modify." msgstr "Høgreklikk på teiknstilen «Internett-lenkje» eller «Vitja Internett-lenkje» og vel Rediger." #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "par_idN10834\n" "help.text" msgid "In the dialog, select the new attributes, and click OK." msgstr "Merk dei nye eigenskapane i dialogvindauget og trykk OK." #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "hd_id3147530\n" "34\n" "help.text" msgid "Edit a hyperlink button" msgstr "Redigera ein hyperlenkjeknapp" #: hyperlink_edit.xhp msgctxt "" "hyperlink_edit.xhp\n" "par_id3152361\n" "13\n" "help.text" msgid "If the hyperlink is a button, click on the border to select it, or press the OptionAlt key while clicking. Open the Properties dialog through the context menu. You can edit the label text under \"Caption,\" and modify the address in the \"URL\" field." msgstr "Viss hyperlenkja er ein knapp, kan du trykka på kanten for å merka han, eller trykka ValAlt medan du klikkar. Opna dialogvindauget Eigenskapar via sprettoppmenyen. Du kan redigera etiketteksten under «Etikett» og forandra adressa i «URL feltet»." #: hyperlink_insert.xhp msgctxt "" "hyperlink_insert.xhp\n" "tit\n" "help.text" msgid "Inserting Hyperlinks" msgstr "Setja inn hyperlenkjer" #: hyperlink_insert.xhp msgctxt "" "hyperlink_insert.xhp\n" "bm_id3150789\n" "help.text" msgid "hyperlinks; insertinglinks; insertinginserting; hyperlinks" msgstr "hyperlenkjer; setja innlenkjer; setja innsetja inn; hyperlenkjer" #: hyperlink_insert.xhp msgctxt "" "hyperlink_insert.xhp\n" "hd_id3150789\n" "4\n" "help.text" msgid "Inserting Hyperlinks" msgstr "Setja inn hyperlenkjer" #: hyperlink_insert.xhp msgctxt "" "hyperlink_insert.xhp\n" "par_id3149095\n" "5\n" "help.text" msgid "You can insert hyperlinks in two ways: as text or as a button. In both cases, the visible text can be different from the URL." msgstr "Du kan setja inn hyperlenkjer på to måtar: Som tekst eller som ein knapp. Den synlege teksten kan vera ulik URL-en." #: hyperlink_insert.xhp msgctxt "" "hyperlink_insert.xhp\n" "par_id3149811\n" "8\n" "help.text" msgid "Place the text cursor in the document at the point where you want to insert the hyperlink or select the text that you want to put the hyperlink on. Select Hyperlink command from the Insert menu. Alternatively click on the Icon Hyperlink icon on the Standard toolbar. The Hyperlink dialog appears." msgstr "Set markøren i dokumentet der du ønskjer å setja inn hyperlenkja eller merk teksten som du ønskjer å leggja hyperlenkja i. Vel Hyperlenkje frå Set inn på hovudmenyen. Du kan også trykke på hyperlenkjeikonet Ikonstandardverktøylinja for å få opp dialogvindauget Hyperlenkje." #: hyperlink_insert.xhp msgctxt "" "hyperlink_insert.xhp\n" "par_id3154685\n" "23\n" "help.text" msgid "To jump to a specific line in a text document, first enter a bookmark at that position (Insert - Bookmark)." msgstr "Vil du gå til ei bestemt linje i eit tekstdokument, må du først setja inn eit bokmerke på denne linja (Set inn → Bokmerke)." #: hyperlink_insert.xhp msgctxt "" "hyperlink_insert.xhp\n" "par_idN1076D\n" "help.text" msgid "To jump to a cell in a spreadsheet, first enter a name for the cell (Insert - Names - Define)." msgstr "Viss du vil gå til ei bestemt celle i eit rekneark, må du først gje cella eit namn (Set inn → Namn → Skriv inn)." #: hyperlink_insert.xhp msgctxt "" "hyperlink_insert.xhp\n" "par_id3152887\n" "24\n" "help.text" msgid "Hyperlinks can also be inserted by drag-and-drop from the Navigator. Hyperlinks can refer to references, headings, graphics, tables, objects, directories or bookmarks." msgstr "Du kan også setja inn hyperlenkjer ved å dra og sleppa dei frå dokumentstrukturen. Hyperlenkjer kan visa til referansar, overskrifter, bilete, tabellar, objekt, mapper eller bokmerke." #: hyperlink_insert.xhp msgctxt "" "hyperlink_insert.xhp\n" "par_id3146975\n" "34\n" "help.text" msgid "If you wish to insert in a text a hyperlink that refers to Table 1, drag the entry Table 1 from the Navigator and drop it in the text. To do this, the Insert as Hyperlink drag mode must be selected in the Navigator." msgstr "Viss du vil setja inn ei hyperlenkje som viser til Tabell1 i ein tekst, kan du dra elementet Tabell1 frå «Dokumentstruktur» og sleppa det i teksten. Du kan berre gjera dette viss du har vald dratilstanden Set inn som hyperlenkje i dokumentstrukturen." #: hyperlink_rel_abs.xhp msgctxt "" "hyperlink_rel_abs.xhp\n" "tit\n" "help.text" msgid "Relative and Absolute Links" msgstr "Relative og absolutte lenkjer" #: hyperlink_rel_abs.xhp msgctxt "" "hyperlink_rel_abs.xhp\n" "bm_id3147399\n" "help.text" msgid "absolute hyperlinksrelative hyperlinkshyperlinks; relative and absolutehyperlinks, see also links" msgstr "absolutte hyperlenkjerrelative hyperlenkjerhyperlenkjer; relative og absoluttehyperlenkjer, sjå òg lenkjer" #: hyperlink_rel_abs.xhp msgctxt "" "hyperlink_rel_abs.xhp\n" "hd_id3147399\n" "45\n" "help.text" msgid "Relative and Absolute Links" msgstr "Relative og absolutte lenkjer" #: hyperlink_rel_abs.xhp msgctxt "" "hyperlink_rel_abs.xhp\n" "par_id3153345\n" "46\n" "help.text" msgid "When you include hyperlinks, two factors must be taken into account: whether they are set as relative or absolute on saving, and whether or not the file is present." msgstr "Når du sett inn hyperlenkjer, må du ta omsyn til to faktorar: Om lenkjene er sett som relative eller absolutte når dei vert lagra og om fila finst." #: hyperlink_rel_abs.xhp msgctxt "" "hyperlink_rel_abs.xhp\n" "par_id3147008\n" "47\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - Load/Save - General and specify in the Save URLs relative to field if $[officename] creates relative or absolute hyperlinks. Relative linking is only possible when the document you are working on and the link destination are on the same drive." msgstr "Vel %PRODUCTNAME → InnstillingarVerktøy → InnstillingarLast inn/lagra → Generelt og merk av i feltet Lagra for at nettadresser alltid skal lagrast som relativt til filsystemet eller relativt til Internett. Relativ lenking er berre mogleg når dokumentet du arbeidar med og lenkjemålet er på det same lagringsmediet." #: hyperlink_rel_abs.xhp msgctxt "" "hyperlink_rel_abs.xhp\n" "par_id3145382\n" "48\n" "help.text" msgid "You should create the same directory structure on your hard disk as that which exists in the web space hosted by your Internet provider. Call the root directory for the homepage on your hard disk \"homepage\", for example. The start file is then \"index.html\", the full path being \"C:\\homepage\\index.html\" (assuming Windows operating system). The URL on your Internet provider's server might then be as follows: \"http://www.myprovider.com/mypage/index.html\". With relative addressing, you indicate the link relative to the location of the output document. For example, if you placed all the graphics for your homepage in a subfolder called \"C:\\homepage\\images\", you would need to give the following path to access the graphic \"picture.gif\": \"images\\picture.gif\". This is the relative path, starting from the location of the file \"index.html\". On the provider's server, you would place the picture in the folder \"mypage/images\". When you transfer the document \"index.html\" to the provider's server through the File - Save As dialog, and if you have marked the option Copy local graphics to Internet under %PRODUCTNAME - PreferencesTools - Options - Load/Save - HTML Compatibility, $[officename] will automatically copy the graphic to the correct directory on the server." msgstr "Du må laga den same mappestrukturen på harddisken som den du brukar på nettstaden der filene vert lagra. Kall rota for heimesida på harddisken for eksempel for «heimesida». Du kan då bruke startfila «index.html». I Windows vert då den fulle stien til denne mappa «C:\\heimesida\\index.html». Adressa på Internettenaren kan då verta slik: ««http://www.nettstaden_min.no/sida_mi/index.html». Med relativ adressering vert lenkja sett opp relativt til plasseringa av dokumentet lenkja ligg i. Legg du for eksempel alle bileta for heimesida i mappa «C:\\heimesida\\bilete», og dette biletet skal leggjast inn i «index.html», vert lenkjeadressa til biletet «solnedgang.png» «bilete\\solnedgang.png». Dette er den relative stien som byrjar der fila «index.html» er plassert. På nettenaren legg du dette biletet i mappa «sida_mi/bilete». Når du overfører dokumentet «index.html» til nettenaren via Fil - Lagra som og du har merkt av for Kopier lokale bilete til Internett i %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → Last inn/lagra → HTML-komptibilitet vil $[officename] kopiera bileta automatisk til den rette mappa på tenaren." #: hyperlink_rel_abs.xhp msgctxt "" "hyperlink_rel_abs.xhp\n" "par_id3159158\n" "49\n" "help.text" msgid "An absolute path such as \"C:\\homepage\\graphics\\picture.gif\" would no longer function on the provider server. Neither a server nor the computer of a reader needs to have a C hard drive: operating systems such as Unix or MacOS do not recognize drive letters, and even if the folder homepage\\graphics existed, your picture would not be available. It is better to use relative addressing for file links." msgstr "Ein absolutt sti, som for eksempel «C:\\heimeside\\bilete\\bilete.gif\" vil ikkje verka på leverandøren sin tenar. Korkje tenaren eller lesaren sin datamaskin treng å ha ein C-stasjon. Operativsystem som Unix og MacOS kjenner ikkje stasjonsbokstavar. Sjølv om mappa «hemieside\\bilete» finst, vil ikkje bileta dine vera tilgjengelege. Det er betre å bruka relativ adressering for fil-lenkjer." #: hyperlink_rel_abs.xhp msgctxt "" "hyperlink_rel_abs.xhp\n" "par_id3154046\n" "50\n" "help.text" msgid "A link to a web page, for example, \"www.example.com\" or \"www.myprovider.com/mypage/index.html\" is an absolute link." msgstr "Ei lenkje til ei nettside, for eksempel «www.openoffice.org» eller «www.nettstaden_min.no/sida_mi/index.html» er ei absolutt lenkje." #: hyperlink_rel_abs.xhp msgctxt "" "hyperlink_rel_abs.xhp\n" "par_id3155450\n" "51\n" "help.text" msgid "$[officename] also reacts differently, depending on whether the file referred to in the link exists, and where it is located. $[officename] checks every new link and sets a target and protocol automatically. The result can be seen in the generated HTML code after saving the source document." msgstr "$[officename] reagerer også ulikt, avhengig av om fila som viser til i lenkja finst og kvar ho er plassert. $[officename] kontrollerer alle nye lenkjer og velr automatisk eit mål og ein protokoll. Resultatet er synleg i den genererte HTML-koden etter at kjeldedokumentet er lagra." #: hyperlink_rel_abs.xhp msgctxt "" "hyperlink_rel_abs.xhp\n" "par_id3145317\n" "52\n" "help.text" msgid "The following rules apply: A relative reference (\"graphic/picture.gif\") is only possible when both files exist on the same drive. If the files are on different drives in your local file system, the absolute reference follows the \"file:\" protocol (\"file:///data1/xyz/picture.gif\"). If the files are on different servers or if the target of the link is not available, the absolute reference uses the \"http:\" protocol (\"http://data2/abc/picture.gif\")." msgstr "Desse reglane gjeld: Ein relativ referanse («bilete/bilete.gif») er berre mogleg når begge filene finst på den same stasjonen. Viss filene er på ulike stasjonar i det lokale filsystemet, vil den absolutte referansen bruka «file:»-protokollen («file:///data1/xyz/bilete.gif»). Viss filene finst på ulike tenarar, eller viss målet for lenkja ikkje er tilgjengeleg, vil den absolutte referansen bruka «http:»-protokollen («http://data2/abc/bilete.gif»)." #: hyperlink_rel_abs.xhp msgctxt "" "hyperlink_rel_abs.xhp\n" "par_id3153541\n" "53\n" "help.text" msgid "Be sure to organize all files for your homepage on the same drive as the start file of the homepage. In this way, $[officename] can set the protocol and target so that the reference on the server is always correct." msgstr "Pass på at du plasserer alle filene som skal brukast på heimesida på den same lagringseininga som startfila for heimesida er på. På denne måten kan $[officename] velja protokollen og målet slik at referansen på tenaren alltid er korrekt." #: hyperlink_rel_abs.xhp msgctxt "" "hyperlink_rel_abs.xhp\n" "par_id3153897\n" "54\n" "help.text" msgid "When you rest your mouse on a hyperlink, a help tip displays the absolute reference, since $[officename] uses absolute path names internally. The complete path and address can only be seen when you view the result of the HTML export, by loading the HTML file as \"Text\" or opening it with a text editor." msgstr "Sidan $[officename] brukar absolutte stinamn internt, vil tipset som kjem opp når du held musepeikaren over ei hyperlenkje alltid visa den absolutte referansen. Den fullstendige stien og adressa er berre synleg når du viser resultatet av HTML-eksporten ved å lasta inn HTML-fila som «Tekst», eller når du opnar ho i eit skriveprogram." #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "tit\n" "help.text" msgid "Adding Clickable Hotspots to Images" msgstr "Leggja til klikkbare område i bilete" #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "bm_id3150502\n" "help.text" msgid "ImageMap; editor editors; ImageMap editor images; ImageMap pictures; ImageMap hotspots;adding to images URL;in pictures" msgstr "biletkart; redigering redigering; biletkartredigering bilete; biletkart lenkjeområde;leggja til i bilete URL;i bilete" #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN10631\n" "help.text" msgid "Adding Clickable Hotspots to Images" msgstr "Leggja til klikkbare område i bilete" #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN1064F\n" "help.text" msgid "An ImageMap allows you to attach URLs to specific areas, called hotspots, on a picture in your document. An image map is a group of one or more hotspots." msgstr "Med eit biletkart kan du leggja URL-ar inn i bestemte område, såkalla lenkjeområde, i eit bilete i eit dokument. Eit biletkart er ei gruppe som sett saman av eitt eller fleire lenkjeområde." #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN1066C\n" "help.text" msgid "You can draw three types of hotspots: rectangles, ellipses, and polygons. When you click a hotspot, the URL is opened in the browser window or frame that you specify. You can also specify the text that appears when your mouse rests on the hotspot." msgstr "Du kan teikna tre slags lenkjeområde: rektangel, ellipsar og mangekantar. Når du trykkjer på eit lenkjeområde, vert nettadressa opna i nettlesarvindauget eller ramma du vel. Du kan òg velja teksten som skal verta vist når musepeikaren kviler på lenkjeområdet." #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN10677\n" "help.text" msgid "To add a clickable hotspot to an image" msgstr "Slik legg du til eit klikkbart lenkjeområde i eit bilete" #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN1067E\n" "help.text" msgid "Position the cursor where you want the ImageMap in your document." msgstr "Plasser markøren der du vil setja inn biletkartet i dokumentet." #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN10682\n" "help.text" msgid "Choose Insert - Image, select and insert a bitmap image." msgstr "Vel Set inn → Bilete, merk og set inn eit punktbilete." #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN1068A\n" "help.text" msgid "With the image selected, choose Edit - ImageMap. You see the ImageMap Editor, which displays the image at the background." msgstr "Pass på at biletet er merkt og vel så Rediger → Biletkart. Dette vil opna vindauget for biletkartredigering med biletet i bakgrunnen." #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN106A0\n" "help.text" msgid "Use the icons in the ImageMap Editor to draw a hotspot shape, for example a rectangle, over the image at the background." msgstr "Bruk knappane i biletkartredigeringa til å teikna eit lenkjeområde, for eksempel eit rektangel, over biletet i bakgrunnen." #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN106A3\n" "help.text" msgid "You can see an extended help text on the functions of each icon when you enable Extended Help in %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME - General." msgstr "du kan få fram ein utvida hjelpetekst for funksjonane til kvart ikon ved å krysse av for «Utvida tips» i %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → %PRODUCTNAME → Generelt." #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN106AB\n" "help.text" msgid "Enter the \"Address\" URL that will be shown in a Web browser when the user clicks the hotspot." msgstr "Skriv inn «Adresse»-URL-en som skal visast i nettlesaren når ein brukar trykkjer på lenkjeområdet." #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN106AF\n" "help.text" msgid "Optionally, enter the \"Text\" that will be shown as a tip when the user points the mouse to the hotspot." msgstr "Eventuelt kan du også skriva inn «Tekst» som vert vist som eit tips når brukaren plasserer peikaren på lenkjeområdet." #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN106B3\n" "help.text" msgid "Click the Apply button to apply your changes, and close the ImageMap Editor." msgstr "Trykk på «Bruk» for å bruka endringa og lukk biletkartredigeringa." #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN106B7\n" "help.text" msgid "Save the document in the %PRODUCTNAME or HTML format." msgstr "Lagra dokumentet i %PRODUCTNAME- eller i HTML-format." #: imagemap.xhp msgctxt "" "imagemap.xhp\n" "par_idN106BA\n" "help.text" msgid "You may save the ImageMap as a file and upload that file to a Web server, for example." msgstr "Du kan lagra biletkartet som ei fil, som du for eksempel kan lasta opp til ein nettenar." #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "tit\n" "help.text" msgid "Opening documents saved in other formats" msgstr "Opna dokument lagra i andre format" #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "bm_id3153988\n" "help.text" msgid "Microsoft Office;opening Microsoft documents documents; importing importing; documents in other formats opening; documents from other formats loading; documents from other formats converting;Microsoft documents saving; default file formats defaults;document formats in file dialogs file formats; saving always in other formats Microsoft Office; as default file format files;importing XML converters converters; XML Document Converter Wizard wizards; document converter converters; document converter files, see also documents" msgstr "Microsoft Office;Opna Microsoft-dokumentdokument; importeraimportera; dokument i andre formatopna; dokument frå andre formatlasta inn; dokument frå andre formatkonvertera Microsoft-dokumentlagra; standardfilformatstandardar; filformat i fildialogarfilformat; lagra alltid i andre formatMicrosoft Office; som standard filformatfiler;importeringXML-konverteringkonvertering; XMLDokumentkonvertering, vegvisarvegvisarar; dokumentkonverteringkonverterarar; dokumentkonverterteringfiler, sjå også dokument" #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "hd_id3145313\n" "2\n" "help.text" msgid "Opening documents saved in other formats" msgstr "Opna dokument som er lagra i andre format" #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "par_id3145345\n" "3\n" "help.text" msgid "You can open a document saved in another format by using the following procedure:" msgstr "Du kan opna eit dokument som er lagra i eit anna format på denne måten:" #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "par_id3147242\n" "4\n" "help.text" msgid "Choose File - Open." msgstr "Vis Fil → Opna." #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "par_id3152780\n" "5\n" "help.text" msgid "Select a format from the Files of type list." msgstr "Vel eit format frå lista Filtype." #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "par_id3148491\n" "6\n" "help.text" msgid "Select a file name and click Open." msgstr "Merk eit filnamn og trykk på Opna." #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "par_id3159399\n" "8\n" "help.text" msgid "If you always want the file dialogs to show another format by default, choose %PRODUCTNAME - PreferencesTools - Options - Load/Save - General and select that format as Default file format." msgstr "Viss du vil at fildialogvindauget alltid skal visa eit anna filformat som standard, vel %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → Last inn/lagra → Generelt og merk formatet som Standard filformat." #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "hd_id3154898\n" "9\n" "help.text" msgid "Converting all documents of a folder" msgstr "Gjer om alle dokumenta i ei mappe" #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "par_id3147336\n" "10\n" "help.text" msgid "Open the wizard, which guides you through the operation, to copy and convert all documents from Microsoft Word, Microsoft Excel or Microsoft PowerPoint into OpenDocument file format documents. You can select a source and target directory, specify whether to convert documents and/or templates, and more besides." msgstr "Opna vegvisaren som viser deg korleis du kan kopiera og konvertera alle Microsoft Word, Microsoft Excel og Microsoft PowerPoint-dokument til OpenDocument-filformat. Du kan velja ei kjeldemappe og ei målmappe, og velja om du vil konvertere dokument og/eller malar og så vidare." #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "par_id3153824\n" "11\n" "help.text" msgid "Choose File - Wizards - Document Converter." msgstr "Vel Fil → Vegvisarar → Dokumentkonvertering." #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "hd_id4563127\n" "help.text" msgid "Opening HTML files in Writer" msgstr "Opna HTML-filer i Writer" #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "par_id9207434\n" "help.text" msgid "Choose the file type \"HTML Document\" to open in %PRODUCTNAME Writer/Web. This is the default for HTML documents in %PRODUCTNAME." msgstr "Vel filtypen «HTML-dokument» for å opna fila i %PRODUCTNAME Writer/Web. Dette er standard for HTML-dokument i %PRODUCTNAME." #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "par_id7215491\n" "help.text" msgid "All the options of %PRODUCTNAME Writer/Web are now available to you, such as Show HTML source." msgstr "Nå er alle innstillingane i %PRODUCTNAME Writer/Web tilgjengelege, mellom anna Vis HTML-kjelde." #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "par_id2299874\n" "help.text" msgid "Choose \"HTML Document (%PRODUCTNAME Writer)\" to open in %PRODUCTNAME Writer." msgstr "Vel «HTML-dokument (%PRODUCTNAME Writer)» for å opna dokumentet i %PRODUCTNAME Writer." #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "par_id1727347\n" "help.text" msgid "All the options of %PRODUCTNAME Writer are now available to you. Not all options that %PRODUCTNAME Writer offers for editing of documents can be saved in HTML format." msgstr "Alle innstillingane i %PRODUCTNAME Writer er nå tilgjengelege. Ikkje alle vala som %PRODUCTNAME Writer tilbyr for redigering av dokument kan lagrast i HTML-format." #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "par_id3148944\n" "12\n" "help.text" msgid "Working with VBA code" msgstr "Arbeida med VBA-kode" #: import_ms.xhp msgctxt "" "import_ms.xhp\n" "par_id3147264\n" "13\n" "help.text" msgid "Setting the default file format" msgstr "Vel standard filformat" #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "tit\n" "help.text" msgid "Inserting, Editing, Saving Bitmaps" msgstr "Setja inn, redigera og lagra punktbilete" #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "bm_id3154136\n" "help.text" msgid "graphics, see also picturesimages, see also picturesimages; inserting and editing bitmapsillustrations, see picturesbitmaps; inserting and editingpixel graphics; inserting and editingexporting; bitmapsimporting; bitmapspictures; editingediting; picturesinvert filtersmoothing filtersharpening filterremove noise filtersolarization filteraging filterposterizing filterpop-art filtercharcoal sketches filtermosaic filterpictures;filtersfilters;pictures" msgstr "grafikk, sjå også bileteteikning, sjå også biletebilete; setja inn og redigera punktbileteillustrasjonar, sjå biletepunktbilete; setja inn og redigerapunktgrafikk; setja inn og redigeraeksportera; punktbileteimportera; punktbiletebilete; redigeringredigera; bileteinvertera filterutjamningsfilterskarpleiksfilterstøyfjerningsfiltersolariasjonsfilteraldringsfilterplakatfeltfilterpopart-filterkolskissefiltermosaikkfilterbilete;filterfilter;bilete" #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "hd_id3154136\n" "1\n" "help.text" msgid "Inserting, Editing, Saving Bitmaps" msgstr "Setja inn, redigera og lagra punktbilete" #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "hd_id3149811\n" "2\n" "help.text" msgid "Inserting Bitmaps" msgstr "Setja inn punktbilete" #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3153031\n" "3\n" "help.text" msgid "A bitmap image can be inserted in $[officename] Writer, $[officename] Calc, $[officename] Draw and $[officename] Impress documents." msgstr "Du kan setja inn punktbilete i dokument laga med $[officename] Writer, $[officename] Calc, $[officename] Draw og $[officename] Impress." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3147209\n" "4\n" "help.text" msgid "Choose Insert - Image - From File." msgstr "Vel Set inn → Bilete → Frå fil." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3149236\n" "5\n" "help.text" msgid "Select the file. In the File type box you can restrict the selection to certain file types." msgstr "Merk fila. I feltet Filtype kan du avgrensa utvalet til bestemte filtypar." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3153126\n" "6\n" "help.text" msgid "Click the Link box if you want a link to the original file." msgstr "Merk av i boksen Lenkje viss du vil setja inn ei lenkje til den opphavlege fila." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3154306\n" "7\n" "help.text" msgid "If the Link box is marked, whenever the document is updated and loaded the bitmap image is reloaded. The editing steps that you have carried out in the local copy of the image in the document are re-applied and the image is displayed." msgstr "Viss du merkjer av for Lenkje, vert punktbiletet oppdatert kvar gong dokumentet vert oppdatert og lasta inn. Viss du har gjort endringar i den lokale kopien av biletet i dokumentet, vert bildet oppdatert med endringane før det vert vist." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3147336\n" "8\n" "help.text" msgid "If the Link box is not marked, you are always working with the copy created when the graphic was first inserted." msgstr "Viss det ikkje er merkt av for Lenkje, arbeidar du alltid med kopien som vart laga den første gongen biletet vart sett inn." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3153824\n" "26\n" "help.text" msgid "To embed graphics that were first inserted as links, go to Edit - Links and click the Break Link button." msgstr "For å byggja inn bilete som først vart lagt inn som lenkje, vel Rediger → Lenkjer og klikk på knappen Bryt lenkje." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3151384\n" "9\n" "help.text" msgid "Click Open to insert the image." msgstr "Trykk på Opna for å setja inn biletet." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "hd_id3147303\n" "10\n" "help.text" msgid "Editing Bitmaps" msgstr "Redigera punktbilete" #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "hd_id187078\n" "help.text" msgid "Icons on the Image bar" msgstr "Knappar på biletverktøylinja" #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3148552\n" "11\n" "help.text" msgid "When you select the bitmap image, the Image Bar offers you the tools for editing the image. Only a local copy is edited in the document, even if you have inserted an image as a link." msgstr "Når du merkjer eit bilete, vil verktøylinja for bilete innehalda dei verktøya du treng for å redigera biletet. All redigeringa vert gjort på ein lokal kopi av biletet sjølv om du har sett inn biletet som ei lenkje." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3159413\n" "12\n" "help.text" msgid "The Image Bar may look slightly different depending to the module you are using." msgstr "Utsjånaden på verktøylinja for bilete vil variera i høve til kva modul du bruker." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3154124\n" "13\n" "help.text" msgid "A number of filters are located on the Graphic Filter toolbar, which you can open with the icon on the Image Bar." msgstr "Du finn fleire filter i menyen Filter som du opnar ved å trykka på filterknappen på verktøylinja for bilete." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id7055574\n" "help.text" msgid "The original image file will not be changed by the filters. Filters are applied to an image only inside the document." msgstr "Det opphavlege biletet vert ikkje endra av filtra. Filtra vert berre brukte på eit bilete inne i dokumentet." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3145273\n" "14\n" "help.text" msgid "Some of the filters open a dialog, which you can use to select, for example, the intensity of the filter. Most filters can be applied multiple times to increase the filter effect." msgstr "Nokre filter opnar eit dialogvindauge som du kan bruka til å velja for eksempel intensiteten for filteret. Dei fleste filtra kan brukast fleire gonger for å forsterka verknaden av filteret." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3150105\n" "15\n" "help.text" msgid "In $[officename] Draw and $[officename] Impress, you can add text and graphics, select these objects together with the bitmap, and export the selection as a new bitmap image." msgstr "I $[officename] Draw og $[officename] Impress kan du leggja til tekst og bilete, merka desse saman med objekta og punktbiletet og eksportera valet som eit nytt punktbilete." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "hd_id2572405\n" "help.text" msgid "The Image dialog" msgstr "Biletdialogvindauget" #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id6457411\n" "help.text" msgid "Right-click the image and choose Image from the submenu to open a properties dialog." msgstr "Høgreklikk på biletet og vel Bilete på sprettoppmenyen for å opna eit dialogvindauge for ulike biletinnstillingar." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id7991882\n" "help.text" msgid "Change the properties of the selected image, then click OK." msgstr "Endra eigenskapane for det valde biletet og trykk «OK»." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "hd_id3153574\n" "16\n" "help.text" msgid "Saving Bitmaps" msgstr "Lagra punktbilete" #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3152576\n" "17\n" "help.text" msgid "If you want to save in a format such as GIF, JPEG or TIFF, you must select and export the bitmap image." msgstr "Viss du vil lagra eit bilete i eit format som GIF, JPEG eller TIFF, må du merka og eksportera punktbiletet." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id0801200803544667\n" "help.text" msgid "To export a bitmap in Draw or Impress:" msgstr "Eksportera eit punktbilete i Draw eller Impress:" #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3155414\n" "18\n" "help.text" msgid "Select the bitmap image. You can also select additional objects, such as text, to be exported with the image by pressing the shift key while selecting or by opening a selection frame around all objects." msgstr "Merk punktbiletet. Du kan også velja å eksportera fleire objekt, som for eksempel tekst, saman med biletet ved å halda nede Shift-tasten samstundes som du merker, eller ved å dra eit rektangelutval rundt alle objekta." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3148618\n" "19\n" "help.text" msgid "Choose File - Export. The Export dialog opens." msgstr "Vel Fil → Eksporter for å opna dialogvindauget Eksporter." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3157139\n" "help.text" msgid "The Export command writes the image with all applied filter effects to a file. The Save Image command in the context menu saves the image without any filter effects, if the image was inserted as a linked image. An embedded image will always be saved or exported with filters applied." msgstr "Kommandoen Eksport lagrar biletet med alle filtereffektane til ei fil. Kommandoen Lagra biletet i sprettoppmenyen vil lagra biletet utan filtereffektane viss biletet er sett inn som eit lenkja bilete. Eit innebygd bilete vert alltid lagra eller eksportert saman med filtereffektane." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3083443\n" "20\n" "help.text" msgid "In the File format field, select the file format you want, for example GIF or JPEG." msgstr "Vel filformatet du vil bruka i feltet Filformat, for eksempel GIF eller JPEG." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3152462\n" "21\n" "help.text" msgid "If you only want to export the selected objects, mark the Selection box." msgstr "Viss du berre vil eksportera dei merkte objekta, set du eit merke i feltet Utval." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3150874\n" "22\n" "help.text" msgid "If Selection is not marked, the entire page of the document is exported." msgstr "Viss det ikkje er merkt av i Val, vert heile dokumentet eksportert." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id3149417\n" "23\n" "help.text" msgid "Enter a name for the file and click Export." msgstr "Skriv inn eit namn på fila og trykk på Eksporter." #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id0801200803525078\n" "help.text" msgid "To export a bitmap in Writer: Right-click the bitmap, choose Save Graphics. You see the Image Export dialog. Enter a file name and select a file type." msgstr "Slik eksporterer du eit punktbilete i Writer: Høgreklikk på biletet og vel Lagra bilete for å få fram dialogvindauget for eksportering. Skriv inn eit filnamn og vel filtype. " #: insert_bitmap.xhp msgctxt "" "insert_bitmap.xhp\n" "par_id1033051\n" "help.text" msgid "Graphic Filter Bar from the Image Bar" msgstr "Biletfiltra frå biletlinja" #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "tit\n" "help.text" msgid "Editing Graphic Objects" msgstr "Redigera biletobjekt" #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "bm_id3145136\n" "help.text" msgid "resizing, see also scaling/zooming scaling, see also zooming drawings, see also draw objects graphic objects, see draw objects text; drawing pictures inserting; drawings pictures; drawing objects; copying when moving in presentations draw objects; adding/editing/copying circle drawings square drawings handles; scaling scaling; objects objects;moving and resizing with mouse resizing;objects, by mouse copying; draw objects pasting;draw objects editing;draw objects pictures;scaling/resizing" msgstr "endra storleik, sjå også skalering/lupeskalera, sjå også lupeteikningar, sjå også teikneobjektgrafikkobjekt, sjå også teikneobjekttekst; teikna biletesetja inn; teikningarbilete; teikningarobjekt; kopiera ved flytting i presentasjonarteikneobjekt; leggja til/redigera/kopierasirkelteikningarkvadratteikningarhandtak; skaleringskalering; objektobjekt;flytte og endra storleik med musendra storleik;objekt, med muskopiera; teikneobjektlime inn;teikneobjektredigera;teikneobjektbilete;skalering/endra storleik" #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "hd_id3145136\n" "11\n" "help.text" msgid "Editing Graphic Objects" msgstr "Redigera biletobjekt" #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "par_id3153345\n" "9\n" "help.text" msgid "Choose View - Toolbars - Drawing to open the Drawing toolbar, if it is not already open." msgstr "Vel Vis → Verktøylinjer → Teikning for å opna verktøylinja Teikning, viss ho ikkje er opna frå før." #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "par_id3166460\n" "2\n" "help.text" msgid "Drawing objects can be subsequently edited and modified. Drawing objects created in this way are vector graphics, which you can scale freely without any loss of quality." msgstr "Teikneobjekt kan redigerast og endrast etter når som helst. Teikneobjekt som er laga på denne måten er vektorbilete, og kan såleis skalerast utan tap av kvalitet." #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "par_id3148491\n" "3\n" "help.text" msgid "To create a rectangle, click the rectangle icon and move your cursor to the place in the document where you want one corner of the rectangle to be. Press the mouse button and hold it down while dragging to the opposite corner of the rectangle. When you release the mouse button, the rectangle is inserted in the document. It is selected, and you can edit its properties through the context menu." msgstr "Viss du vil teikna eit rektangel, kan du trykka på rektangelknappen og flytta musepeikaren til staden i dokumentet der du vil ha det eine hjørnet i rektangelet. Trykk ned museknappen og hald han nede medan du drar til det motsette hjørnet i rektangelet. Når du slepp museknappen, vert rektangelet sett inn i dokumentet. Rektangelet er merkt, og du kan redigera eigenskapane ved hjelp av sprettoppmenyen." #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "par_id3149164\n" "13\n" "help.text" msgid "To draw multiple objects of the same type, double-click the icon.To draw multiple objects of the same type, double-click the icon.Draw multiple objects of the same type. Click the document without moving the mouse to stop drawing objects." msgstr "Vel sideoppsettstilen som skal brukast i dokumentet." #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "par_id3148473\n" "4\n" "help.text" msgid "If you want to open up draw objects from the center instead of dragging from one corner to the other, hold down the OptionAlt key while dragging. With some window managers, you may need to hold down also the meta key." msgstr "For å dela ei tabellcelle i staden for å leggja til ein kolonne, trykkjer du Tilval Alt + Insert og held deretter KommandoCtrl nede medan du trykkjer Pil venstre eller Pil høgre." #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "par_id9448225\n" "help.text" msgid "Holding down the Shift key while dragging restricts the created object. For example, instead of a rectangle you get a square, instead of an ellipse you get a circle. When you drag a handle of an existing object with Shift held down, the aspect ratio of the object is retained." msgstr "Viss du held nede Shift medan du dreg, vil dette avgrensa objekta du lagar. For eksempel får du eit kvadrat i staden for eit rektangel eller ein sirkel i staden for ein ellipse. Når du dreg eit handtak til eit eksisterande objekt og samstundes held nede Shift, vert forholdet mellom breidd og høgd i objektet uendra." #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "par_id3153626\n" "5\n" "help.text" msgid "To scale the objects, first select them by clicking on them with the selection tool. You then see eight handles around the object. When you drag one of the four corner handles, the opposite corner remains fixed while the other three corners move. When you drag one of the side handles, the opposite side remains fixed." msgstr "Skal du skalera eit objekt, må du først merka det ved å trykka på Vel og deretter på objektet. Då kjem det fram åtte handtak rundt objektet. Når du dreg i eitt av de fire hjørnehandtaka, vert det motsette hjørnet halde fast på same staden medan dei tre andre hjørna kan flyttast. Når du dreg i eitt av sidehandtaka vert den motsette sida halde fast på same staden." #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "par_id224616\n" "help.text" msgid "To scale a draw object using the keyboard, first select the object, then press CommandCtrl+Tab repeatedly to highlight one of the handles. Then press an arrow key. To scale in smaller steps, hold down the OptionAlt key while pressing an arrow key. Press Esc to leave the point edit mode." msgstr "For å dela ei tabellcelle i staden for å leggja til ein kolonne, trykkjer du Tilval Alt + Insert og held deretter KommandoCtrl nede medan du trykkjer Pil venstre eller Pil høgre." #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "par_id3149669\n" "6\n" "help.text" msgid "To move draw objects, first select them. To select more than one object, press the Shift key while clicking. Select text objects by clicking exactly on their edge. While holding down the mouse button, drag the objects to the new location." msgstr "For å flytta teikneobjekt, må du først merka dei. Treng du å markera fleire objekt, held du nede Shift-tasten medan du klikkar. Dra objektet til den nye staden medan du held nede museknappen." #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "par_id7199316\n" "help.text" msgid "To move a draw object using the keyboard, first select the object, then press an arrow key. To move in smaller steps, hold down the OptionAlt key while pressing an arrow key." msgstr "For å sletta ei rad, plasserer du skrivemerket i ei tabellcelle, trykkjer Tilval Alt + Delete og deretter Pil opp eller Pil ned." #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "par_id7133399316\n" "help.text" msgid "To enter text to be a part of a graphics object, select the object and start typing your text. Click outside the object to end entering text. Double-click text inside an object to edit the text." msgstr "For å skriva inn tekst som ein del av eit grafisk objekt, merk objektet og skriv teksten. Klikk utanfor objektet når du er ferdig. Ønskjer du seinare å redigera teksten, dobbeltklikkar du først inne i objektet." #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "par_id3156422\n" "8\n" "help.text" msgid "To revert to normal mode after creating and editing draw objects, click in an area of the document containing no objects. If you see a drawing cursor, first exit this mode by clicking the Select icon." msgstr "Klikk i eit område av dokumentet som ikkje inneheld objekt for å gå tilbake til normaltilstanden etter at du har oppretta eller redigert eit teikne-objekt. Viss du ser ein teiknemarkør, må du først gå ut av teiknetilstanden ved å trykka ikonet Vel." #: insert_graphic_drawit.xhp msgctxt "" "insert_graphic_drawit.xhp\n" "par_id3145785\n" "10\n" "help.text" msgid "Information about the individual icons" msgstr "Informasjon om dei einskilde knappane" #: insert_specialchar.xhp msgctxt "" "insert_specialchar.xhp\n" "tit\n" "help.text" msgid "Inserting Special Characters" msgstr "Setja inn spesialteikn" #: insert_specialchar.xhp msgctxt "" "insert_specialchar.xhp\n" "bm_id3154927\n" "help.text" msgid "characters; specialinserting; special charactersspecial characterstext; inserting special charactersaccentscompose key to insert special characters" msgstr "teikn; spesialteiknsetja inn; spesialteiknspesialteikntekst; setja inn spesialtegnunderstrekingtast for å setja inn spesialteikn" #: insert_specialchar.xhp msgctxt "" "insert_specialchar.xhp\n" "hd_id3154927\n" "1\n" "help.text" msgid "Inserting Special Characters" msgstr "Setja inn spesialteikn" #: insert_specialchar.xhp msgctxt "" "insert_specialchar.xhp\n" "par_id3147576\n" "2\n" "help.text" msgid "This function allows you to insert special characters, such as check marks, boxes, and telephone symbols, into your text." msgstr "Med denne funksjonen kan du setja inn spesialteikn som hakar, boksar og telefonsymbol i teksten." #: insert_specialchar.xhp msgctxt "" "insert_specialchar.xhp\n" "par_id3155535\n" "3\n" "help.text" msgid "To view a selection of all characters, choose Insert - Special Character." msgstr "Du kan sjå eit utval av alle teikna ved å velja Set inn → Spesialteikn." #: insert_specialchar.xhp msgctxt "" "insert_specialchar.xhp\n" "par_id3147275\n" "6\n" "help.text" msgid "In the large selection field click the desired character or several characters in succession. The characters are displayed at the bottom of the dialog. When you close the dialog with OK, all displayed characters in the selected font are inserted in the current document." msgstr "I det store valfeltet kan du trykka på teiknet du vil setja inn, eller fleire teikn etter kvarandre. Teikna vert viste nedst i dialogvindauget. Alle dei viste teikna vert sette inn i dokumentet i den valde skrifttypen når du lukkar vindauget ved å trykka på OK." #: insert_specialchar.xhp msgctxt "" "insert_specialchar.xhp\n" "par_id3153031\n" "4\n" "help.text" msgid "In any text input field (such as the input fields in the Find & Replace dialog) you can press Shift+CommandCtrl+S to open the Special Characters dialog." msgstr "I eit tekstskrivefelt (for eksempel inndatafelt i dialogvindauget Søk og byt ut ) kan du trykka Shift + CmdCtrl+ S for å opna dialogvindauget Spesialteikn." #: insert_specialchar.xhp msgctxt "" "insert_specialchar.xhp\n" "par_id3155630\n" "7\n" "help.text" msgid "At present there are three ways of entering letters with accents directly from the keyboard." msgstr "For tida er det tre måtar å skriva inn teikn med aksent direkte frå tastaturet." #: insert_specialchar.xhp msgctxt "" "insert_specialchar.xhp\n" "par_id3154897\n" "8\n" "help.text" msgid "Solaris: Using a Sun keyboard. First press the Compose key to the right of the space bar, then enter the first and second modifiers." msgstr "Solaris: Ved bruk av eit Sun-tastatur trykk først tasten Compose til høgre for mellomromtasten og deretter første og andre modifiseringstasten." #: insert_specialchar.xhp msgctxt "" "insert_specialchar.xhp\n" "par_id3145315\n" "9\n" "help.text" msgid "Linux / NetBSD: Using the dead-keys. In an xterm window first press the (´) or (`) key. The character should not appear on the screen. Now press a letter, such as \"e\". The e is given an accent, é or è. If not, then check in the XF86Config file if a \"nodeadkeys\" XkbdVariant has been loaded there and replace it. You may also have set the environment variable SAL_NO_DEADKEYS, which deactivates the dead-keys." msgstr "Linux / NetBSD: Bruke dødtastane. I eit xterm-vindauge trykker du først på tasten (´) eller (`). Teiknet skal ikkje kome fram på skjermen. Deretter trykker du ein bokstav, for eksempel «e». Aksentteiknet vert nå lagt til bokstaven og skriv é eller è på skjermen. Dersom dette ikkje skjer, må du kontrollere om XF86Config-fila inneheld ein \"nodeadkeys\" XkbdVariant og bytte ut den. Du kan også ha aktivert miljøvariabelen SAL_NO_DEADKEYS, som deaktiverer dødtastane." #: insert_specialchar.xhp msgctxt "" "insert_specialchar.xhp\n" "par_id3148943\n" "10\n" "help.text" msgid "All Unix systems: (Alt Graph) as additional compose key. The (Alt Graph) key can work in $[officename] like the Compose key, if you set the environment variable SAL_ALTGR_COMPOSE. The (Alt Graph) key must trigger a mode_switch, so, for example, xmodmap -e \"keysym Alt_R = Mode_switch\" must be set. First press (Alt Graph), then the first modifier, then the second modifier. The characters are combined as described on a Solaris system in the file /usr/openwin/include/X11/Suncompose.h." msgstr "Alle Unix-system: «Alt Gr» som ekstra valtast. Tasten «Alt Gr» kan brukast i $[officename] som valtast viss du definerer miljøvariablen SAL_ALTGR_COMPOSE. Tasten «Alt Gr» må løysa ut ein modusbrytar (mode_switch), så difor må for eksempel xmodmap -e \"keysym Alt_R = Mode_switch\" vera sett. Trykk først ned «Alt Gr», så den første valtasten og deretter den andre. Teikna vert kombinerte slik som omtalt i Solaris-system i fila /usr/openwin/inkluder/X11/Suncompose.h. " #: insert_specialchar.xhp msgctxt "" "insert_specialchar.xhp\n" "par_id3149047\n" "5\n" "help.text" msgid "Special Characters" msgstr "Spesialteikn" #: insert_specialchar.xhp msgctxt "" "insert_specialchar.xhp\n" "par_id3153896\n" "11\n" "help.text" msgid "AutoCorrect" msgstr "Autoretting" #: integratinguno.xhp msgctxt "" "integratinguno.xhp\n" "tit\n" "help.text" msgid "Integrating new UNO components" msgstr "Integrera nye UNO-komponentar" #: integratinguno.xhp msgctxt "" "integratinguno.xhp\n" "bm_id3149760\n" "help.text" msgid "add-ons, see UNO componentsUNO components;integrating newinstalling;UNO components" msgstr "programtillegg, sjå UNO-komponentarUNO-komponentar;integrera nyeinstallera;UNO-komponentar" #: integratinguno.xhp msgctxt "" "integratinguno.xhp\n" "hd_id3149760\n" "7\n" "help.text" msgid "Integrating new UNO components" msgstr "Integrera UNO-komponentar" #: integratinguno.xhp msgctxt "" "integratinguno.xhp\n" "par_id3147571\n" "1\n" "help.text" msgid "Programmers can write and integrate their own UNO (Universal Network Objects) components to $[officename]. Those new components can be added to the $[officename] menus and toolbars; we call them \"Add-Ons\"." msgstr "Programmerarar kan skriva og integrera sine eigne UNO-komponentar (Universal Network Objects) i $[officename]. Desse nye komponentane kan leggjast til i i $[officename]-menyar og verktøylinjer. Vi kallar dei «tillegg»." #: integratinguno.xhp msgctxt "" "integratinguno.xhp\n" "par_id3154751\n" "2\n" "help.text" msgid "The integration of new components is supported by some tools and services. Details can be found in the $[officename] Developer's Guide. The three main steps are as follows:" msgstr "Integrasjonen av nye komponentar er støtta av nokre verktøy og tenester. Du finn meir informasjon i $[officename] Developer's Guide. Dei tre hovudstega er:" #: integratinguno.xhp msgctxt "" "integratinguno.xhp\n" "par_id3153748\n" "3\n" "help.text" msgid "Register the new components within $[officename]. This can be accomplished using the tool unopkg, which can be found in {installpath}/ \\program." msgstr "Registrer dei ny komponentane i $[officename]. Dette kan gjerast med verktøyet unopkg, som ligg i {installasjonssti}/ \\." #: integratinguno.xhp msgctxt "" "integratinguno.xhp\n" "par_id3153345\n" "4\n" "help.text" msgid "Integrate the new components as services. The ProtocolHandler and JobDispatch services assist you; more information can be found in the $[officename] Developer's Guide." msgstr "Integrer dei nye komponentane som tenester. Tenestene «ProtocolHandler» og «JobDispatch» hjelper deg med dette. Du finn meir informasjon om dette i i $[officename] Developer's Guide." #: integratinguno.xhp msgctxt "" "integratinguno.xhp\n" "par_id3166460\n" "5\n" "help.text" msgid "Change the user interface (menus or toolbars). This can be done almost automatically by writing an XML text file that describes the changes. More information can be found in the $[officename] Developer's Guide." msgstr "Endra brukargrensesnittet (menyar og verktøylinjer). Dette kan gjerast nesten automatisk ved å skriva ei XML-tekstfil som forklarar endringane. Du finn meir informasjon om dette i $[officename] Developer's Guide." #: integratinguno.xhp msgctxt "" "integratinguno.xhp\n" "par_id3151110\n" "6\n" "help.text" msgid "The Add-Ons can extend the functionality of $[officename]. They are not related to the Add-InsAdd-Ins that provide new functions for $[officename] Calc." msgstr "Tillegga kan utvida funksjonane i $[officename]. Dei har ingenting å gjera med tilleggatillegga som gjev nye funksjonar i $[officename] Calc." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "tit\n" "help.text" msgid "Shortcuts (%PRODUCTNAME Accessibility)" msgstr "Snøggtastar (tilgjenge i %PRODUCTNAME)" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "bm_id3158421\n" "help.text" msgid "accessibility;general shortcuts shortcut keys; %PRODUCTNAME accessibility" msgstr "tilgjenge; generelle snøggtastarsnøggtastar; tilgjenge i %PRODUCTNAME" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3158421\n" "52\n" "help.text" msgid "Shortcuts (%PRODUCTNAME Accessibility)" msgstr "Snøggtastar (tilgjengelege i %PRODUCTNAME)" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3159201\n" "25\n" "help.text" msgid "You can control %PRODUCTNAME without using a mouse device, using only the keyboard." msgstr "Du kan styra %PRODUCTNAME utan å bruka datamus, berre ved hjelp av tastaturet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3149177\n" "24\n" "help.text" msgid "On each module's main help page (for example, the %PRODUCTNAME Writer or %PRODUCTNAME Calc main help page) there is a link to access the keyboard shortcuts' help for that module." msgstr "På hovudsida for kvar modul (for eksempel, hovudhjelpa for %PRODUCTNAME Writer eller %PRODUCTNAME Calc), finst det ei lenkje som viser til hjelpa for snartastane i denne modulen." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3145382\n" "23\n" "help.text" msgid "In addition, under the keyword \"Accessibility\" you find step-by-step instructions about how to control the selected module without a mouse device." msgstr "I tillegg kan du under nøkkelordet «Tilgjenge» finna rettleiingar med fleire steg som forklarar korleis du kan kan bruka den valde modulen utan mus." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3166460\n" "22\n" "help.text" msgid "Working with the %PRODUCTNAME user interface without mouse" msgstr "Arbeida med %PRODUCTNAME-brukargrensesnittet utan mus" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3154749\n" "39\n" "help.text" msgid "Activating menu bar, toolbars, windows, and document" msgstr "Slå på menylinja, verktøylinjer, vindauge og dokument" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3156329\n" "38\n" "help.text" msgid "Repeatedly pressing F6 switches the focus and circles through the following objects:" msgstr "Ved å trykka på F6 vil fokus sirkla gjennom desse objekta:" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3150669\n" "37\n" "help.text" msgid "menu bar," msgstr "menylinje," #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3149234\n" "36\n" "help.text" msgid "every toolbar from top to bottom and from left to right," msgstr "alle verktøylinjer frå øvst til nedst og frå venstre mot høgre," #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3147618\n" "35\n" "help.text" msgid "every free window from left to right," msgstr "alle ledige vindauge frå venstre mot høgre," #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3154514\n" "34\n" "help.text" msgid "document" msgstr "dokument" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3153252\n" "32\n" "help.text" msgid "Press Shift+F6 to switch through objects in the opposite direction." msgstr "Trykk Shift + F6 for å sirkla gjennom objekta i motsett retning." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3152473\n" "31\n" "help.text" msgid "Press CommandCtrl+F6 to switch to the document." msgstr "Trykk CmdCtrl + F6 for å byta til dokumentet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3152360\n" "30\n" "help.text" msgid "Press F10 to switch to the menu bar and back." msgstr "Trykk F10 for å byta til menylinja og tilbake." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3153896\n" "29\n" "help.text" msgid "Escape closes an open submenu, a toolbar, or the current free window." msgstr "Escape lukker ein opna undermeny, ei verktøylinje eller det gjeldande, ledige vindauget." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3161656\n" "21\n" "help.text" msgid "Calling a menu command" msgstr "Kalla opp ein menykommando" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3151056\n" "20\n" "help.text" msgid "Press OptionAlt or F6 or F10 to select the first menu (the File menu). With right arrow, the next menu to the right is selected; with left arrow, the previous menu." msgstr "Trykk TilvalgAlt eller F6 eller F10 for å velja den første menyen (Filmenyen). Med Pil høgre vert den neste menyen til høgre vald. Med Pil venstre vert den førre menyen vald." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3153381\n" "19\n" "help.text" msgid "Arrow down opens a selected menu. Any additional arrow down and up arrow move the selection through the menu commands. With right arrow you open any existing submenus." msgstr "Pil ned opnar den merkte menyen. Kvar gong du trykkjer Pil ned og Pil opp vert valet flytt gjennom menykommandoane. Med Pil høgre kan du opna ein eksisterande undermeny." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3148798\n" "18\n" "help.text" msgid "Press Enter to execute the selected menu command." msgstr "Trykk Enter for å utføra den merkte menykommandoen." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3147086\n" "17\n" "help.text" msgid "Executing an icon command" msgstr "Utføra ein ikonkommando" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3148922\n" "16\n" "help.text" msgid "Press F6 repeatedly until the first icon on the toolbar is selected. Use the right and left arrows to select an icon on a horizontal toolbar. Similarly, use the up and down arrows to select an icon on a vertical toolbar. The Home key selects the first icon on a toolbar and the End key, the last." msgstr "Trykk F6 fleire gonger til den første knappen på verktøylinja er merkt. Bruk Pil høgre og Pil venstre for å velja ein knapp på ei vassrett verktøylinje. På same måten kan du bruka Pil opp og Pil ned for å velja ein knapp på ei loddrett verktøylinje. Viss du trykkjer Home, vert den første knappen på ei verktøylinje merkt og viss du trykkjer End, den siste." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3144433\n" "15\n" "help.text" msgid "Press Enter to execute the selected icon. If the selected icon normally demands a consecutive mouse action, such as inserting a rectangle, then pressing the Enter key is not sufficient: in these cases press CommandCtrl+Enter." msgstr "Trykk Enter for å bruka det merkte ikonet. Viss den merkte knappen normalt krev at du også utfører ei handling med musa, som for å setja inn eit rektangel, er det ikkje nok å trykke på Enter. I slike tilfelle må du trykke CmdCtrl + Enter." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3153968\n" "28\n" "help.text" msgid "Pressing CommandCtrl+Enter on an icon for creating a draw object. A draw object will be placed into the middle of the view, with a predefined size." msgstr "Trykk CmdCtrl + Enter på ein knapp for å laga eit teikneobjekt. Eit teikneobjekt med ein førehandsvald storleik vert då sett inn midt i visinga." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3150449\n" "27\n" "help.text" msgid "Press CommandCtrl+Enter on the Selection tool to select the first draw object in the document. If you want to edit, size, or move the selected draw object, first use CommandCtrl+F6 to set the focus into the document." msgstr "Trykk CmdCtrl + Enter på markerings-verktøyet for å velja det første teikneobjektet i dokumentet. BrukCmdCtrl + F6 for å setja fokuset i dokumentet viss du vil redigera, skalera eller flytta det valde teikneobjektet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3151041\n" "26\n" "help.text" msgid "If a toolbar is longer than can be displayed on screen, it shows an icon at the right or lower edge. Select the toolbar and press PageUp or PageDown to display the remaining icons." msgstr "Viss ei verktøylinje er for lang til å visast på skjermen, vert det vist ein knapp til høgre eller i underkant av verktøylinja. Merk verktøylinja og trykk Page Up eller Page Down for å visa resten av knappane." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3150440\n" "14\n" "help.text" msgid "Special hints for toolbars" msgstr "Spesielle hint for verktøylinjer" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3149983\n" "13\n" "help.text" msgid "Press the down arrow or right arrow to open the selected toolbar. This is equivalent to a mouse click. In the toolbar use the right arrow and left arrow keys. The Home and End keys select the first and last icon in the toolbar, respectively." msgstr "Trykk Pil ned eller Pil høgre for å opna den valde verktøylinja. Dette svarar til eit museklikk. Bruk Pil høyre og Pil venstre i verktøylinja. Home og End merkjer den første og den siste knappen i verktøylinja." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3145365\n" "12\n" "help.text" msgid "Close the toolbar with Esc. It is not possible to move the toolbar without a mouse." msgstr "Lukk verktøylinja ved å trykka på Escape. Det er ikkje råd å flytta verktøylinja utan mus." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3151119\n" "11\n" "help.text" msgid "Selection from a combo box" msgstr "Val frå ein kombinasjonboks" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3146986\n" "help.text" msgid "Combo box" msgstr "Kombinasjonsboks" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3149666\n" "10\n" "help.text" msgid "Select the combo box. Press Enter." msgstr "Merk av i kombinasjonsboksen og trykk Enter." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3155366\n" "9\n" "help.text" msgid "Use the down arrow or Page Down key to scroll down the combo box entries, or the up arrow or Page Up key to scroll upwards. The Home key takes you to the first entry and the End key takes you to the last entry." msgstr "Bruk Pil ned eller Page Down for å rulla nedover gjennom elementa i kombinasjonsboksen, og Pil opp eller Page Up til å rulla oppover. Home tar deg til det første elementet og End til det siste elementet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3145749\n" "8\n" "help.text" msgid "Press Enter to execute the selected entry." msgstr "Trykk Enter for å bruka det valde elementet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3150685\n" "41\n" "help.text" msgid "Selection in Tables" msgstr "Val i tabellar" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3154320\n" "42\n" "help.text" msgid "In several windows, dialogs, and in the table control field, there are tables to select data, for instance, in the right part of the Data Source View. The following keys are used for selections in these tables:" msgstr "I mange vindauge, dialogvindauge og i tabellkontrollfelt er det tabellar for å velja data. For eksempel i den høgre delen i Datakjeldevising. Desse tastane vert brukte for val i desse tabellane:" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3154014\n" "43\n" "help.text" msgid "Spacebar: switches from selection of the current row and cancellation of any selection, but not if the current cell is in edit mode." msgstr "Mellomrom: byter mellom merking av den gjeldande rada og annullering av all merking, men ikkje viss cella er i redigeringstilstand." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3147396\n" "44\n" "help.text" msgid "CommandCtrl+spacebar: switches between selection of the current row and cancellation of this selection." msgstr "CmdCtrl + mellomrom: byter mellom merking av den gjeldande rada og annullering av merkinga." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3149488\n" "45\n" "help.text" msgid "CommandCtrl+Shift+spacebar: switches between selection of the current column and cancellation of this selection." msgstr "CmdCtrl + Shift + mellomrom: byter mellom merking av den gjeldande kolonnen og annullering av merkinga." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3156286\n" "73\n" "help.text" msgid "OptionAlt+Up Arrow or OptionAlt+Down Arrow: moves the window separator between table and form, for instance in the bibliography database." msgstr "ValAlt + Pil opp eller ValAlt + Pil ned: flyttar vindaugeskiljet mellom tabellar og skjema. For eksempel i litteraturdatabasen." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3145251\n" "147\n" "help.text" msgid "In a table control or in the data source view, the Tab key moves to the next column. To move to the next control, press CommandCtrl+Tab. To move to the previous control, press Shift+CommandCtrl+Tab." msgstr "I ein tabellkontroll eller i ei datakjeldevisning vil Tabulator flytta til den neste kolonnen. For å flytta til det neste kontrollelementet, trykk CmdCtrl + Tabulator. For å flytta til det førre kontrollelementet, trykk Shift + CmdCtrl + Tabulator." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3150592\n" "7\n" "help.text" msgid "Size and Position of Windows and Dialogs" msgstr "Storleik og plassering av vindauge og dialogvindauge" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3153221\n" "6\n" "help.text" msgid "First press OptionAlt+spacebar." msgstr "Trykk først TilvalAlt + Mellomrom." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3148456\n" "5\n" "help.text" msgid "A system menu opens with menu commands like Move, Resize and Close." msgstr "Nå vert det opna ein systemmeny som inneheld menykommandoar som Flytt, Endra storleik og Lukk." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3149400\n" "4\n" "help.text" msgid "Choose a command (down arrow, then Enter)." msgstr "Vel ein kommando (trykk Pil ned og deretter Enter)." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3155083\n" "3\n" "help.text" msgid "Now you can use the arrow keys to move or resize the dialog or window." msgstr "Nå kan du bruka piltastane til å flytta eller endra storleiken på dialogvindauget eller vindauget." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3147497\n" "2\n" "help.text" msgid "Press Enter to accept the change. Press Escape to cancel the changes." msgstr "Trykk Enter for å godta endringa. Trykk Escape for å forkasta endringa." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3146988\n" "150\n" "help.text" msgid "Docking and Undocking Windows and Toolbars" msgstr "Festa og losna vindauge og verktøylinjer" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3147176\n" "151\n" "help.text" msgid "Press F6 until the window or toolbar is selected." msgstr "Trykk F6 til vindauget eller verktøylinja er merkt." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3153707\n" "152\n" "help.text" msgid "Press CommandCtrl+Shift+F10." msgstr "Trykk CmdCtrl + Shift + F10." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3154479\n" "148\n" "help.text" msgid "Selecting objects" msgstr "Merke objekt" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3148993\n" "149\n" "help.text" msgid "Press Shift+F4 to select the first object in the current document. When an object is selected, press Tab to select the next object, or press Esc to go back to the text." msgstr "Trykk Shift + F4 for å merka det første objektet i det gjeldande dokumentet. Når eit objekt er merkt, trykk tabulatortasten for å velja det neste objektet eller trykk Escape for å gå tilbake til teksten." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3152962\n" "54\n" "help.text" msgid "Edit Objects" msgstr "Redigera objekt" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3156379\n" "53\n" "help.text" msgid "A selected OLE object can be activated with the Enter key." msgstr "Eit merkt OLE-objekt kan slåast på med Enter." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3155766\n" "55\n" "help.text" msgid "Edit Position and Size of Objects" msgstr "Redigera plassering og storleik for objekt" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3148405\n" "56\n" "help.text" msgid "Use the arrow keys to move the selected object by one grid resolution unit." msgstr "Bruk piltastane til å flytta det valde objektet med ei eining i rutenettoppløysinga." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3145619\n" "57\n" "help.text" msgid "Set the grid resolution unit with %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME Writer - Grid in the Resolution area. If you enter a number greater than 1 in the Subdivision area, you must press the arrow key as often as the number states to move the selected object by one grid resolution unit." msgstr "Set rutenettoppløysinga med %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → %PRODUCTNAME Writer → Rutenett i området Oppløysing. Viss du skriv inn eit tal større enn 1 i området Underinndeling må du trykka piltasten så mange gonger som talet seier for å flytta det valde objektet ei rutenetteining." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3166450\n" "58\n" "help.text" msgid "Use the OptionAlt and arrow keys to move the selected object by one pixel." msgstr "Bruk ValAlt og piltastane for å flytta det valde objektet éin piksel." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3147345\n" "59\n" "help.text" msgid "Use CommandCtrl+Tab to enter the handle edit mode. The upper left handle is the active handle, it starts blinking. Use CommandCtrl+Tab to select the next handle. Press Escape to exit the handle edit mode." msgstr "Bruk CmdCtrl + Tabulator for å gå til handtaksredigeringstilstand. Det øvste handtaket til venstre er det aktive handtaket, det byrjar å blinka. Bruk CmdCtrl + Tabulator for å velja neste handtak. Trykk Escape for å gå ut av handtaksredigeringstilstanden." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3149565\n" "60\n" "help.text" msgid "In the handle edit mode, the arrow keys move the selected handle, which changes the object size." msgstr "I tilstand for redigering av handtak flytter piltastane det valde handtaket, som endrar storleiken på objektet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3147361\n" "61\n" "help.text" msgid "Edit the Anchors of Objects" msgstr "Redigera ankera for objekt" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3148534\n" "62\n" "help.text" msgid "You can move the anchor of an object with the arrow keys. First enter the handle edit mode and select the anchor. Depending on the type of anchor, you can then move the anchor in different directions." msgstr "Du kan flytte ankeret til eit objekt ved hjelp av piltastane. Gå først til tilstand for redigering av handtak og merk ankeret. Nå kan du flytta ankeret i ulike retningar, avhengig av ankertypen." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3163808\n" "63\n" "help.text" msgid "Select the object." msgstr "Vel objektet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3150646\n" "64\n" "help.text" msgid "Enter the handle edit mode with CommandCtrl+Tab." msgstr "Gå til handtaksredigeringstilstand med CmdCtrl + Tabulator." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3150940\n" "65\n" "help.text" msgid "The upper left handle starts blinking. Press CommandCtrl+Tab several times, until no handle blinks. This signals that now the anchor of the object is activated. In text documents you can press Shift+CommandCtrl+A to activate the anchor directly." msgstr "Det øvre, venstre handtaket byrjar å blinka. Trykk CmdCtrl + Tabulator fleire gonger til ingen handtak blinkar. Dette betyr at forankringa av objektet er slått på. I tekstdokument kan du trykka Shift + CmdCtrl + A for å slå på forankringa direkte." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3153919\n" "66\n" "help.text" msgid "Use the arrow keys to move the anchor. The object follows the anchor as appropriate." msgstr "Bruk piltastane til å flytta ankeret. Objektet følgjer ankeret." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3152582\n" "67\n" "help.text" msgid "You can change the anchor of the selected object for example in the object's context menu." msgstr "Du kan endra ankeret til det valde objektet i sprettoppmenyen til objektet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3148393\n" "68\n" "help.text" msgid "If the object is anchored To Paragraph, the arrow keys move the object to the previous or next paragraph." msgstr "Viss objektet er forankra Til avsnitt, flytter piltastane objektet til førre eller neste avsnitt." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3145615\n" "69\n" "help.text" msgid "If the object is anchored To page, the keys Page Up or Page Down move it to the previous or next page." msgstr "Viss objektet er forankra Til side, flytter Page Up og Page Down til den førre eller neste sida." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3145135\n" "70\n" "help.text" msgid "If the object is anchored To character, the Arrow keys move it through the current paragraph." msgstr "Viss objektet er forankra Til teikn, flytter piltastane objektet gjennom det gjeldande avsnittet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3145256\n" "71\n" "help.text" msgid "If the object is anchored As character, no anchor icon exists. You cannot move the object." msgstr "Viss objektet er forankra Som teikn, vil det ikkje ha nokon ankerknapp. Du kan ikkje flytta objektet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3149527\n" "72\n" "help.text" msgid "If the object is anchored To frame, the Arrow keys move it to the next frame in the respective direction." msgstr "Viss objektet er forankra Til ramme, flyttar piltastane objektet til neste ramme i den aktuelle retninga." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3153270\n" "133\n" "help.text" msgid "Controlling the Dividing Lines" msgstr "Handtera skiljelinjene" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3158413\n" "134\n" "help.text" msgid "Documents of %PRODUCTNAME Calc, %PRODUCTNAME Draw, and %PRODUCTNAME Impress can be split horizontally and vertically into separate views. Each view can show other parts of the document. Using the mouse, you can drag a dividing line from the scrollbar into the document." msgstr "%PRODUCTNAME Calc-, %PRODUCTNAME Draw- og %PRODUCTNAME Impress-dokument kan delast inn vassrett og loddrett i skilde visingar. Kvar visning kan syna ulike delar av dokumentet. Du kan bruka musa til å dra ei skiljelinje frå rullefeltet inn i dokumentet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3149814\n" "135\n" "help.text" msgid "Shift+CommandCtrl+F6: shows the dividing lines at default positions and focus a line." msgstr "Shift + CmdCtrl + F6 viser skiljelinjene i standardposisjoner og fokuserer på ei linje." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3158444\n" "136\n" "help.text" msgid "Arrow keys: moves the current dividing line a big step in the arrow direction." msgstr "Piltastar: Flytter den gjeldande skiljelinja eit stort steg i den retninga pila peikar." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3163668\n" "137\n" "help.text" msgid "Shift+Arrow keys: moves the current dividing line a small step in the arrow direction." msgstr "Shift + piltastar: Flytter den gjeldande skiljelinja eit lite steg i den retninga pila peikar." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3148426\n" "138\n" "help.text" msgid "Delete: deletes the current dividing line" msgstr "Delete: Slettar den gjeldande skiljelinja" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3151277\n" "139\n" "help.text" msgid "Shift+Delete: deletes both dividing lines" msgstr "Shift+Delete: Slettar begge skiljelinjene" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3150383\n" "140\n" "help.text" msgid "Enter: fixes the current position of the dividing lines" msgstr "Enter: Låser skiljelinjene til den gjeldande plasseringa." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3150369\n" "141\n" "help.text" msgid "Escape: resets the current dividing line to its default position" msgstr "Escape: Tilbakestiller den gjeldande skiljelinja til standardplasseringa" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3154492\n" "112\n" "help.text" msgid "Controlling the Data Source View" msgstr "Handtera datakjeldevisinga" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3150515\n" "113\n" "help.text" msgid "F4: opens and closes the data source view." msgstr "F4: Opnar og lukker datakjeldevisinga." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3159109\n" "114\n" "help.text" msgid "F6: switches between document and toolbars." msgstr "F6: Byter mellom dokumentet og verktøylinjene." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3153229\n" "115\n" "help.text" msgid "+ (plus key): expands the selected entry in the data source explorer." msgstr "+ (plusstasten): Utvidar det merkte elementet i datakjeldeutforskaren." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3150312\n" "116\n" "help.text" msgid "- (minus key): collapses the selected entry in the data source explorer." msgstr "- (minustast): Faldar saman det merkte elementet i datakjeldeutforskaren." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3154368\n" "117\n" "help.text" msgid "CommandCtrl+Shift+E: switches between data source explorer and table." msgstr "CmdCtrl + Shift + E: byter mellom datakjeldeutforskaren og tabellen." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3147171\n" "118\n" "help.text" msgid "Shortcuts in the Query Design Window" msgstr "Snøggtastar i vindauget for spørjingsutforming" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3152455\n" "119\n" "help.text" msgid "F6: switches between object bar, table view, and selection area." msgstr "F6: Skifter mellom objektlinja, tabellvisinga og utvalsområdet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3151180\n" "120\n" "help.text" msgid "OptionAlt+Up arrow or OptionAlt+Down arrow: moves the border between table view and selection area up or down." msgstr "TilvalAlt + Pil opp eller TilvalAlt + Pil ned: flyttar kanten mellom tabellvisinga og utvalsområdet opp eller ned." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3156288\n" "121\n" "help.text" msgid "Keys in the Table View (upper area of the query design) and in the Relations window" msgstr "Tastar i tabellvisinga (øvre området i spørjingsutforminga) og i vindauget for relasjonar" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3156166\n" "122\n" "help.text" msgid "CommandCtrl+Arrow key: moves the selected table in the direction of the arrow." msgstr "CmdCtrl + Piltast: flytter den valde tabellen i den retninga pila peikar." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3147310\n" "123\n" "help.text" msgid "CommandCtrl+Shift+Arrow key: resizes the selected table in the table view." msgstr "CmdCtrl + Shift + Piltast: forandrar storleiken på den valde tabellen i tabellvisinga." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3152986\n" "124\n" "help.text" msgid "Del: removes the selected table or connection from the table view." msgstr "Delete: Fjernar den valde tabellen eller tilkoplinga frå tabellvisinga." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3145384\n" "125\n" "help.text" msgid "Tab: switches between tables and connections in the table view." msgstr "Tabulator: Byter mellom tabellar og koplingar i tabellvisinga." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3154529\n" "126\n" "help.text" msgid "Enter: when a connection is selected, the Enter key opens the Properties dialog of the connection." msgstr "Enter: Når ei kopling er merkt, opnar «Enter»-tasten dialogvindauget Eigenskapar for koplinga." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3159624\n" "127\n" "help.text" msgid "Enter: when a table is selected, the Enter key enters the first data field from the list box into the selection area." msgstr "Enter: Når ein tabell er merkt, vil «Enter» fylla ut det første datafeltet frå listeboksen inn i utvalsområdet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3153816\n" "128\n" "help.text" msgid "Keys in the Selection Area (bottom area of the query design)" msgstr "Taster i utvalsområdet (den nedre delen av spørjingsutformingsvindauget)" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3152896\n" "146\n" "help.text" msgid "CommandCtrl+Left Arrow or Right Arrow: moves the selected column to the left or to the right." msgstr "CmdCtrl + Pil venstre pil eller Pil høgre: flytter den valde kolonnen til venstre eller høgre." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3146152\n" "131\n" "help.text" msgid "Keys in the Table Design Window" msgstr "Tastar i vindauget for tabellutforming" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3151243\n" "132\n" "help.text" msgid "F6: switches between toolbar, column view, and properties area." msgstr "F6: Skifter mellom verktøylinja, kolonnevisinga og eigenskapsområdet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3145075\n" "74\n" "help.text" msgid "Controlling the ImageMap Editor" msgstr "Kontrollere biletkartredigering" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3159096\n" "75\n" "help.text" msgid "Press Tab to select an icon. If you selected one of the icons from Rectangle to Freeform Polygon and you press CommandCtrl+Enter, an object of the selected type is created in default size." msgstr "Trykk «Tabulator» for å merka ein knapp. Viss du valde ein av knappane frå Rektangel til Frihandsmangekant og trykker CmdCtrl + Enter, vert det laga eit objekt av den valde typen i standardstorleiken." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3156016\n" "76\n" "help.text" msgid "If you press Enter while the icon Select is selected, the focus is set into the image window of the ImageMap Editor. Press Esc to set the focus back to the icons and input boxes." msgstr "Viss du trykker «Enter» medan ikonet Vel er merkt, vert fokus sett på biletvindauget i biletkartredigeringa. Trykk «Escape» for å flytta fokus tilbake til knappane og inndatafelta." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3149587\n" "77\n" "help.text" msgid "If the Select icon is selected and you press Ctrl+Enter, the first object in the image window gets selected." msgstr "Viss Vel er merkt og du trykker «Ctrl + Enter», vert det første objektet i biletvindauget vald." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3154343\n" "78\n" "help.text" msgid "Use the icon Edit Points to switch into the point edit mode for polygons and back." msgstr "Bruk knappen Rediger punkt til å skifta til tilstand for punktredigering for mangekantar og tilbake." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3147073\n" "79\n" "help.text" msgid "Use Ctrl+Tab in the image window to select the next point. Use Shift+Ctrl+Tab to select the previous point." msgstr "Bruk Ctrl + Tabulator i biletvindauget for å velja det neste punktet. Bruk Shift + Ctrl + Tabulator for å velja det førre punktet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3153285\n" "80\n" "help.text" msgid "Use the Delete key with the focus in the image window to delete the selected object." msgstr "Bruk Delete-tasten medan fokus er i biletvindauget for å sletta det merkte objektet." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3145377\n" "46\n" "help.text" msgid "Controlling the Help" msgstr "Handtera hjelpa" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3149441\n" "47\n" "help.text" msgid "Press Shift+F1 to display the Extended Tips for the currently selected command, icon or control." msgstr "Trykk «Shift+F2» for å visa Utvida tips for kommandoen, knappen eller kontrollelementet som er merkt." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3154960\n" "48\n" "help.text" msgid "Navigating the main help pages" msgstr "Navigera i hovudhjelpesidene" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3151300\n" "49\n" "help.text" msgid "In the main help pages, use Tab to jump to the next hyperlink or Shift+Tab to jump to the previous link." msgstr "I hovudhjelpesidene kan du bruka Tabulator-tasten til å hoppa til den neste hyperlenkja eller Shift + Tabulator for å hoppa til den førre hyperlenkja." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3155537\n" "50\n" "help.text" msgid "Press Enter to execute the selected hyperlink." msgstr "Trykk Enter for å bruka den valde hyperlenkja." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3154912\n" "51\n" "help.text" msgid "Press Backspace above the Enter key to return to the previous help page." msgstr "Trykk rettetasten for å gå tilbake til den førre sida i hjelpa." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3150894\n" "81\n" "help.text" msgid "Controlling the Text Import dialog (CSV file import)" msgstr "Kontrollera dialogvindauget for tekstimport (CSV-fil-import)" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3153975\n" "82\n" "help.text" msgid "Ruler" msgstr "Linjal" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3152869\n" "83\n" "help.text" msgid "Left or Right Arrow: go one position to the left or to the right" msgstr "Pil venstre eller Pil høgre: Gå ein posisjon til venstre eller til høgre" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3151000\n" "84\n" "help.text" msgid "Ctrl+Left Arrow or Ctrl+Right Arrow: jump to the previous or to the next split" msgstr "Ctrl + Pil venstre eller Ctrl + Pil høgre: Hopp til den førre eller den neste delinga" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3159203\n" "85\n" "help.text" msgid "Ctrl+Shift+Left Arrow or Ctrl+Shift+Right Arrow: move a split one position to the left or to the right" msgstr "Ctrl + Shift + Pil venstre eller Ctrl + Skift + Pil høgre: flytt ei deling éin posisjon til venstre eller til høgre" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3154538\n" "86\n" "help.text" msgid "Home or End: jump to the first or the last possible position" msgstr "Home eller End: hopp til den første eller siste moglege posisjonen" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3155382\n" "87\n" "help.text" msgid "Ctrl+Home or Ctrl+End: jump to the first or the last split" msgstr "Ctrl + Home eller Ctrl + End: hopp til den første eller den siste delinga" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3155894\n" "88\n" "help.text" msgid "Shift+Ctrl+Home or Shift+Ctrl+End: move split to the first or to the last position" msgstr "«Shift + Ctrl + Home» eller «Skift + Ctrl + End»: flytt inndelinga til den første eller til den siste posisjonen" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3145195\n" "89\n" "help.text" msgid "Space key: insert or remove a split" msgstr "Mellomrom: set inn eller slett ei inndeling" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3154647\n" "90\n" "help.text" msgid "Insert key: insert a split (leave existing splits unchanged)" msgstr "Insert: set inn ein ny inndeling (la eksisterande splittar vera uendra)" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3154765\n" "91\n" "help.text" msgid "Delete key: delete a split" msgstr "Delete: slettar ei inndeling" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3154650\n" "92\n" "help.text" msgid "Shift+Delete: delete all splits" msgstr "Shift + Delete: slettar alle inndelingane" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3145368\n" "93\n" "help.text" msgid "Up Arrow or Down Arrow: scroll table down or up one row" msgstr "Pil opp eller Pil ned: bla ei rad opp eller ei rad ned i tabellen" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3155914\n" "94\n" "help.text" msgid "Page Up or Page Down: scroll table down or up one page" msgstr "Page Up eller Page Down: bla ei side opp eller ei side ned i tabellen" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3147492\n" "95\n" "help.text" msgid "Escape key (during mouse drag): cancel drag, move split to old position" msgstr "Escape (ved draoperasjon med musa): avbryt draoperasjonen, flytter delinga tilbake til den gamle posisjonen" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3145216\n" "96\n" "help.text" msgid "Preview" msgstr "Førehandsvising" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3155148\n" "97\n" "help.text" msgid "Left Arrow or Right Arrow: select left or right column and clear other selections" msgstr "Pil venstre eller Pil høgre: merk venstre eller høgre kolonne og fjern andre val" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3150780\n" "98\n" "help.text" msgid "Ctrl+Left Arrow or Ctrl+Right Arrow: move focus to the left or to the right column (does not change selection)" msgstr "Ctrl + Pil venstre eller Ctrl + Pil høgre: flytt fokus til venstre eller høgre kolonne (endrar ikkje markeringa)" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3153811\n" "99\n" "help.text" msgid "Shift+Left Arrow or Shift+Right Arrow: expand or shrink the selected range" msgstr "Shift + Pil venstre eller Shift + Pil høgre: utvidar eller forminskar det valde området" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3146962\n" "100\n" "help.text" msgid "Ctrl+Shift+Left Arrow or Ctrl+Shift+Right Arrow: expand or shrink the selected range (does not change other selections)" msgstr "Ctrl + Shift + Pil venstre eller Ctrl + Shift + Pil høgre: utvidar eller forminskar det valde området (endrar ikkje andre markeringar) " #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3147512\n" "101\n" "help.text" msgid "Home or End: select the first or the last column (use Shift or Ctrl as with cursor keys)" msgstr "Home eller End: Merk den første eller den siste kolonnen (bruk Shift eller Ctrl på same måten som piltastane)" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3154733\n" "104\n" "help.text" msgid "Shift+Space key: select the range from the last selected column to the current column" msgstr "Shift + Mellomrom: Merker området frå den siste valde kolonnen til den gjeldande kolonnen" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3154171\n" "105\n" "help.text" msgid "Ctrl+Shift+Space key: select the range from the last selected column to the current column (does not change other selections)" msgstr "Ctrl + Shift + Mellomrom: Merker området frå den siste valde kolonnen til den gjeldande kolonnen (endrar ikkje andre markeringar)" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3156368\n" "106\n" "help.text" msgid "Ctrl+A: select all columns" msgstr "Ctrl + A: merker alle kolonnar" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3151192\n" "107\n" "help.text" msgid "Shift+F10: open a context menu" msgstr "Shift + F10: opnar ein sprettoppmeny" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3150416\n" "108\n" "help.text" msgid "Ctrl+1 ... Ctrl+7: set the 1st ... 7th column type for the selected columns" msgstr "Ctrl + 1 … Ctrl + 7: set den første … sjuande kolonnetypen for den merkte kolonnen" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3166442\n" "109\n" "help.text" msgid "Up Arrow or Down Arrow: scroll table down or up one row" msgstr "Pil opp eller Pil ned: bla ei rad opp eller ei rad ned i tabellen" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3146103\n" "110\n" "help.text" msgid "Page Up or Page Down: scroll table down or up one page" msgstr "Page Up eller Page Down: bla ei side opp eller ei side ned i tabellen" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3145116\n" "111\n" "help.text" msgid "Ctrl+Home or Ctrl+End: scroll to the top or bottom of a table" msgstr "Ctrl + Home eller Ctrl + End: Blar til toppen eller botnen av ein tabell" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "hd_id3153298\n" "142\n" "help.text" msgid "Controlling the Insert - Special Character Dialog" msgstr "Kontrollera dialogvindauget «Set inn → Spesialteikn»" #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3153073\n" "143\n" "help.text" msgid "Tab switches through all controls in the dialog." msgstr "Tabulator byter mellom alle kontrollelementa i dialogvindauget." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3153295\n" "144\n" "help.text" msgid "OptionAlt+Down Arrow opens a combo box. Enter selects the current entry in the combo box." msgstr "TilvalAlt + Pil ned opnar ein kombinasjonsboks. Enter vel den gjeldande oppføringa i kombinasjonsboksen." #: keyboard.xhp msgctxt "" "keyboard.xhp\n" "par_id3153958\n" "145\n" "help.text" msgid "Arrow buttons move through the main selection area. Spacebar adds the current character to the list of characters to be inserted." msgstr "Pilknappane flytter gjennom hovudutvalsområdet. Mellomromtasten legg det gjeldande teiknet til i lista over teikn som skal setjast inn." #: labels.xhp msgctxt "" "labels.xhp\n" "tit\n" "help.text" msgid "Creating and Printing Labels and Business Cards" msgstr "Laga og skriva ut etikettar og visittkort" #: labels.xhp msgctxt "" "labels.xhp\n" "bm_id3150774\n" "help.text" msgid "labels; creating and synchronizingbusiness cards; creating and synchronizingsynchronizing;labels and business cards" msgstr "etikettar; laga og synkroniseravisittkort; laga og synkroniserasynkronisera;etikettar og visittkort" #: labels.xhp msgctxt "" "labels.xhp\n" "hd_id3150774\n" "4\n" "help.text" msgid "Creating and Printing Labels and Business Cards" msgstr "Laga og skriva ut etikettar og visittkort" #: labels.xhp msgctxt "" "labels.xhp\n" "hd_id3153345\n" "81\n" "help.text" msgid "Designing Business Cards Through a Dialog" msgstr "Utforma visittkort ved hjelp av eit dialogvindauge" #: labels.xhp msgctxt "" "labels.xhp\n" "par_id3146798\n" "70\n" "help.text" msgid "Choose File - New - Business Cards to open the Business Cards dialog, which allows you to choose how your business cards will look." msgstr "Velg Fil → Ny → Visittkort for å opna dialogvindauget Visittkort, der du kan velja korleis visittkorta skal sjå ut." #: labels.xhp msgctxt "" "labels.xhp\n" "hd_id3147654\n" "82\n" "help.text" msgid "Designing Labels and Business Cards" msgstr "Utforma etikettar og visittkort" #: labels.xhp msgctxt "" "labels.xhp\n" "par_id3152349\n" "71\n" "help.text" msgid "You can design both labels and business cards through the Labels dialog." msgstr "Du kan utforma både etikettar og visittkort med dialogvindauget Etikettar." #: labels.xhp msgctxt "" "labels.xhp\n" "par_id3153880\n" "5\n" "help.text" msgid "Choose File - New - Labels to open the Labels dialog." msgstr "Vel Fil → Ny → Etikettar for å opna dialogvindauget Etikettar." #: labels.xhp msgctxt "" "labels.xhp\n" "par_id3149233\n" "32\n" "help.text" msgid "On the Labels tab, under Format, define the label format." msgstr "Vel format for etikettar under Format på fana Etikettar." #: labels.xhp msgctxt "" "labels.xhp\n" "par_id3145674\n" "83\n" "help.text" msgid "$[officename] Writer contains many formats of commercially available sheets for labels, badges, and business cards. You can also add other, user-defined formats." msgstr "$[officename] Writer inneheld mange format av kommersielt tilgjengelege ark for etikettar, skilt og visittkort. Du kan også leggja til andre sjølvvalde format." #: labels.xhp msgctxt "" "labels.xhp\n" "par_id3143271\n" "28\n" "help.text" msgid "On the Labels tab, under Inscription, you can choose what you want written on the labels." msgstr "Du kan velja kva som skal stå på etikettane under Etikettekst på fana Etikettar." #: labels.xhp msgctxt "" "labels.xhp\n" "par_id3145610\n" "84\n" "help.text" msgid "This often involves database fields, so that the labels can be printed with varying content, when sending \"Form Letters\" for example. It is also possible to have the same text printed on every label." msgstr "Dette inkluderer ofte databasefelt, så etikettar kan skrivast ut med varierande innhald når ein for eksempel sender ut «standardbrev». Det er også mogleg å skriva ut den same teksten på alle etikettane." #: labels.xhp msgctxt "" "labels.xhp\n" "par_id3151385\n" "85\n" "help.text" msgid "Use the Database and Table list boxes to select the database and table from which the data fields are obtained. Click on the arrow button to transfer the selected data field into the inscription area. Press Enter to insert a line break. You can also enter spaces and any other fixed text." msgstr "Bruk listene Database og Tabell til å velja databasen og tabellen som datafelta skal hentast frå. Trykk på pilknappen for å overføra det valde datafeltet til tekstområdet. Trykk «Enter» viss du vil setja inn eit linjeskift. Du kan også skriva inn mellomrom og anna fast tekst." #: labels.xhp msgctxt "" "labels.xhp\n" "par_id3147560\n" "6\n" "help.text" msgid "On the Format tab you can define your own label formats, not covered by the predefined formats. To do this, select \"User\" from the Type list box. On the Options tab, you can specify whether all labels or only certain ones are to be created." msgstr "På fana Format kan du definera eigne etikettformat som ikkje finst mellom formata som er definerte på førehand. Dette gjer du ved å velja «Brukar» i feltet «Type» i fana Etikettar. På fana Val kan du velja om du vil laga alle etikettane eller berre nokre av dei." #: labels.xhp msgctxt "" "labels.xhp\n" "par_id3150358\n" "33\n" "help.text" msgid "On the Options tab page, make sure that the Synchronize contents box is selected. If this is selected, a label only has to be entered (on the top left label) and edited once." msgstr "Kontroller at det er merkt av for Synkroniser innhaldet i fana Val. Viss denne avkryssingsboksen er merkt, er det nok at du skriv inn og redigerar innhaldet til berre ein etikett (etiketten øvst til venstre)." #: labels.xhp msgctxt "" "labels.xhp\n" "par_id3156424\n" "86\n" "help.text" msgid "As soon as you click on New Document, you will see a small window with the Synchronize Labels button. Enter the first label. When you click on the Synchronize Labels button, the current individual label is copied to all the other labels on the sheet." msgstr "Så snart du trykkjer på Nytt dokument, vil du sjå eit lite vindauge med knappen Synkroniser etikettane. Skriv inn innhaldet til den første etiketten. Når du trykkjer på Synkroniser etikettane, vert innhaldet frå den gjeldande etiketten kopiert til alle dei andre etikettane på arket." #: labels.xhp msgctxt "" "labels.xhp\n" "par_id3149767\n" "29\n" "help.text" msgid "Click on New Document to create a new document with the settings you have entered." msgstr "Trykk på Nytt dokument for å laga eit nytt dokument med innstillingane du har vald." #: labels.xhp msgctxt "" "labels.xhp\n" "par_id3150449\n" "88\n" "help.text" msgid "Business Cards" msgstr "Visittkort" #: labels_database.xhp msgctxt "" "labels_database.xhp\n" "tit\n" "help.text" msgid "Printing Address Labels" msgstr "Skriva ut adresseetikettar" #: labels_database.xhp msgctxt "" "labels_database.xhp\n" "bm_id3147399\n" "help.text" msgid "address labels from databases labels; from databases stickers databases;creating labels" msgstr "adresseoverskrifter frå databasaroverskrifter; frå databasarlåsardatabasar;laga overskrifter" #: labels_database.xhp msgctxt "" "labels_database.xhp\n" "hd_id3147399\n" "34\n" "help.text" msgid "Printing Address Labels" msgstr "Skriva ut adresseetikettar" #: labels_database.xhp msgctxt "" "labels_database.xhp\n" "par_id3153824\n" "36\n" "help.text" msgid "Choose File - New - Labels to open the Labels dialog." msgstr "Vel Fil → Ny → Etikettar for å opna dialogvindauget Etikettar." #: labels_database.xhp msgctxt "" "labels_database.xhp\n" "par_id3150084\n" "37\n" "help.text" msgid "On the Labels tab page, select the format of the label sheets you want to print on." msgstr "Vel formatet for etikettarka du vil skriva ut på fana Etikettar." #: labels_database.xhp msgctxt "" "labels_database.xhp\n" "par_id0130200903370863\n" "help.text" msgid "Choose the database and table from which to get the data." msgstr "Vel databasen og tabellen som du vil henta data frå." #: labels_database.xhp msgctxt "" "labels_database.xhp\n" "par_id013020090337089\n" "help.text" msgid "Select a database field of which you want to print the contents. Click the button that shows a left arrow to insert the database field into the Label Text box." msgstr "Merk eit databasefelt med innhald som du vil skriva ut. Klikk på knappen som vert vist som ei venstrepil for å setja inn databasefeltet i feltet «Etikett»." #: labels_database.xhp msgctxt "" "labels_database.xhp\n" "par_id0130200903370930\n" "help.text" msgid "Continue to select and insert database fields if you want more fields on every label. You can press Enter to insert a new line, and you can type any character to insert fixed text." msgstr "Hald fram med å merkja og setja inn databasefelt viss du vil ha fleire felt på kvar etikett. Du kan trykkja Enter for å setja inn ei ny linje og du kan skriva eit teikn for å setja inn fast tekst." #: labels_database.xhp msgctxt "" "labels_database.xhp\n" "par_id0130200903370924\n" "help.text" msgid "Optionally, if you want to type more text, apply formatting, or insert images and line art, you should enable Synchronize contents on the Options tab. If you enable this, once you leave the Labels dialog box a small window opens with a Synchronize button. Now you only need to work on the first label on the labels document, then click the Synchronize button to copy your work to every label of the document." msgstr "Viss du vil skriva inn meir tekst, leggja til formatering eller setja inn bilete og strekkunst, slå på knappen Synkroniser innhald på fana Val. Viss du slår på denne, vert eit lite vindauge med ein synkroniseringsknapp vist like etter at du lukker dialogvindauget «Etikettar». Nå treng du berre å arbeida på den første etiketten i dokumentet og så klikka på synkroniseringsknappen for å kopiera til resten av etikettane i dokumentet." #: labels_database.xhp msgctxt "" "labels_database.xhp\n" "par_idN10687\n" "help.text" msgid "Click New Document." msgstr "Trykk på Nytt dokument." #: labels_database.xhp msgctxt "" "labels_database.xhp\n" "par_id3148685\n" "38\n" "help.text" msgid "When you see the label document, you might want to temporarily enable View - Field Names. This displays the fields in a more visible manner, so that you can arrange and edit label contents more easily." msgstr "Når du ser etikettdokumentet, vil du kanskje slå på Vis → Feltnamn mellombels. Dette viser felta på ein meir oversiktleg måte slik at du lettare kan arrangera og redigera innhaldet." #: labels_database.xhp msgctxt "" "labels_database.xhp\n" "par_id3148484\n" "25\n" "help.text" msgid "You can save and/or print the label document." msgstr "Du kan lagra og skriva ut etikettdokumentet." #: labels_database.xhp msgctxt "" "labels_database.xhp\n" "par_id8476821\n" "help.text" msgid "When you choose to print the document, you will be asked if you want to print a form letter. Answer Yes to open the Mail Merge dialog. In the Mail Merge dialog, you can select the records for which you want to print labels." msgstr "Når du skal skriva ut dokumentet, vert du spurd om du vil skriva ut eit standardbrev. Svar «Ja» for å opna dialogvindauget brevfletting der du vel postane som du vil skriva ut etikettar for." #: language_select.xhp msgctxt "" "language_select.xhp\n" "tit\n" "help.text" msgid "Selecting the Document Language" msgstr "Velja språk for dokumentet" #: language_select.xhp msgctxt "" "language_select.xhp\n" "bm_id3083278\n" "help.text" msgid "languages; selecting for text documents; languages characters; language selection character styles;language selection text; language selection paragraph styles; languages drawings; languages defaults;languages spellcheck; default languages dictionaries, see also languages" msgstr "språk; velja for tekstdokument; språkteikn; språkvalteiknstilar; språkvaltekst; språkvalavsnittsstilar; språkteikningar; språkstandardar;språkstavekontroll; standardspråkordlister, sjå også språk" #: language_select.xhp msgctxt "" "language_select.xhp\n" "hd_id3083278\n" "1\n" "help.text" msgid "Selecting the Document Language" msgstr "Velja språk for dokumentet" #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3150040\n" "2\n" "help.text" msgid "The language you select for your document determines the dictionary used for spellcheck, thesaurus and hyphenation, the decimal and thousands delimiter used and the default currency format." msgstr "Språket du vel for dokumentet bestemmer kva for ordliste som skal brukast for stavekontroll, synonymordliste og orddeling. Dessutan også standard valutaformat og kva desimal- og tusenskiljeteikn som skal brukast." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3153093\n" "3\n" "help.text" msgid "The language you select applies to the whole document." msgstr "Språket du vel, gjeld for heile dokumentet." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3152578\n" "4\n" "help.text" msgid "Within the document, you can apply a separate language to any paragraph style. This has priority over the language of the whole document." msgstr "Inne i dokumentet kan du leggja til eit anna språk for kva avsnittstil som helst. Dette har forrang over språket for heile dokumentet." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3152886\n" "5\n" "help.text" msgid "You can assign a language to selected pieces of text in a paragraph, either by direct formatting or with a character style. This assignment has priority over the paragraph style and document language." msgstr "Du kan tildela eit språk til valde delar av teksten inne i eit avsnitt, anten ved hjelp av direkte formatering eller med ein teiknstil. Denne tildelinga har forrang over avsnittstilen og dokumentspråket." #: language_select.xhp msgctxt "" "language_select.xhp\n" "hd_id3146121\n" "6\n" "help.text" msgid "Selecting a language for the whole document" msgstr "Velja eit språk for heile dokumentet" #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3083443\n" "7\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options. Go to Language Settings - Languages." msgstr "Vel %PRODUCTNAME - InnstillingarVerktøy → Innstillingar. Gå til Språkinnstillingar → Språk." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3149664\n" "8\n" "help.text" msgid "Under Default languages for documents, select the document language for all newly created documents. If you mark For the current document only, your choice will only apply to the current document. Close the dialog with OK." msgstr "Under Standardspråk for dokument vel du dokumentspråket for alle nye dokument du lagar. Viss du merkar av for Bare for det gjeldande dokumentet, vert språkvalet berre brukt på det gjeldande dokumentet. Lukk dialogvindauget med OK." #: language_select.xhp msgctxt "" "language_select.xhp\n" "hd_id3152938\n" "9\n" "help.text" msgid "Selecting a language for a Paragraph Style" msgstr "Velja språk for avsnittstil" #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3150872\n" "10\n" "help.text" msgid "Place the cursor in the paragraph whose paragraph style you want to edit." msgstr "Plasser skrivemerket i avsnittet som har avsnittstilen du vil redigera." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3145367\n" "11\n" "help.text" msgid "Open the context menu and select Edit Paragraph Style. This opens the Paragraph Style dialog." msgstr "Opna sprettoppmenyen og vel Rediger avsnittsstil for å opna dialogvindauget Avsnittsstil." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3166413\n" "12\n" "help.text" msgid "Select the Font tab." msgstr "Vel fana Skrift." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3156283\n" "13\n" "help.text" msgid "Select the Language and click OK." msgstr "Vel språket du vil bruka i Språk og trykk på OK." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3154942\n" "14\n" "help.text" msgid "All paragraphs formatted with the current paragraph style will have the selected language." msgstr "Alle avsnitt som er formaterte med den aktuelle avsnittsstilen, vil få det valde språket." #: language_select.xhp msgctxt "" "language_select.xhp\n" "hd_id3145801\n" "15\n" "help.text" msgid "Applying a language directly to selected text" msgstr "Bruka eit språk direkte i den merkte teksten" #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3148455\n" "16\n" "help.text" msgid "Select the text to which you want to apply a language." msgstr "Merk teksten du vil bruka eit språk på." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3159348\n" "17\n" "help.text" msgid "Choose Format - Character. This opens the Character dialog." msgstr "Vel Format → Teikn for å opna dialogvindauget Teikn." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3155600\n" "18\n" "help.text" msgid "Select the Font tab." msgstr "Vel fana Skrift." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3154510\n" "19\n" "help.text" msgid "Select the Language and click OK." msgstr "Vel språket du vil bruka i Språk og trykk på OK." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3154164\n" "20\n" "help.text" msgid "In %PRODUCTNAME Calc, choose Format - Cells and proceed accordingly." msgstr "I %PRODUCTNAME Calc vel du Format → Celler og held fram på tilsvarande måte." #: language_select.xhp msgctxt "" "language_select.xhp\n" "hd_id3154272\n" "21\n" "help.text" msgid "Selecting a language for a Character Style" msgstr "Velja eit språk for ein teiknstil" #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3145649\n" "22\n" "help.text" msgid "Open the Styles and Formatting window and click on the Character Styles icon." msgstr "Opna stilhandsamaren og trykk på Teiknstilar." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3146792\n" "23\n" "help.text" msgid "Click on the name of the character style to which you want to apply a different language." msgstr "Trykk på namnet til den teiknstilen du vil bruka eit anna språk på." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3150753\n" "24\n" "help.text" msgid "Then open the context menu in the Styles and Formatting window and select Modify. This opens the Character Style dialog." msgstr "Opna sprettoppmenyen i stilhandsamaren og vel Rediger for å opna dialogvindauget Teiknstil." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3150321\n" "25\n" "help.text" msgid "Select the Font tab." msgstr "Vel fana Skrift." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3154756\n" "26\n" "help.text" msgid "Select the Language and click OK." msgstr "Vel språket du vil bruka under Språk og trykk på OK." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3155766\n" "27\n" "help.text" msgid "Now you can apply the character style to your selected text." msgstr "Nå kan du bruka denne teiknstilen på den merkte teksten." #: language_select.xhp msgctxt "" "language_select.xhp\n" "hd_id8703268\n" "help.text" msgid "Adding More Text Languages" msgstr "Leggja til fleire tekstspråk" #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id7919248\n" "help.text" msgid "Dictionaries are supplied and installed as extensions. Choose Tools - Language - More Dictionaries Online to open the dictionaries page in your default web browser." msgstr "Ordlister vert leverte og installerte som utvidingar. Vel Verktøy → Språk → Hent fleire ordlister frå Internett for å opna ordlistesida i nettlesaren." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id5174108\n" "help.text" msgid "Select a dictionary in the list of descriptions. Click the heading in a dictionary description that you want to get." msgstr "Vel ei ordliste i lista med skildringar. Klikk på overskrifta i ei ordlisteskildring som du vil ha." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id2897427\n" "help.text" msgid "In the next page, click the Get It icon to download the dictionary extension. Note the folder name to which your browser downloads the file. Download additional dictionaries as you like." msgstr "Klikk på ikonet «Get it» på den neste sida for å lasta ned ordlisteutvidinga. Legg merke til kva mappenamn nettlesaren lagrar fila i. Du kan også lasta ned fleire ordlister" #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3906979\n" "help.text" msgid "In %PRODUCTNAME, choose Tools - Extension Manager and click Add to install the downloaded extensions." msgstr "I %PRODUCTNAME, vel Verktøy → Utvidingar og trykk på «Legg til» for å installera dei nedlasta utvidingane." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id0220200911174493\n" "help.text" msgid "After you installed the extensions, you should close %PRODUCTNAME (including the Quickstarter), and restart." msgstr "Når du har installert utvidinga bør du lukka %PRODUCTNAME (inkludert snøggstart) og starta %PRODUCTNAME på nytt." #: language_select.xhp msgctxt "" "language_select.xhp\n" "hd_id9100924\n" "help.text" msgid "Setting UI Language" msgstr "Velja språk for brukargrensesnittet" #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id2761314\n" "help.text" msgid "A standard installation of %PRODUCTNAME software will give you a user interface (UI) of your chosen language." msgstr "Ein standardinstallasjon av %PRODUCTNAME gjev deg eit brukargrensesnitt (UI) med det valde språket." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3912778\n" "help.text" msgid "Most users download the American English version, which gives you English menu commands and English application help. If you want another language for the menus (and for the application help, if available in that language), change the UI language as follows." msgstr "Viss du har ein norsk versjon, har du brukargrensesnittet og hjelp på norsk. Ønskjer du å bruka eit anna språk i menyar, dialogvindauge (og hjelpa viss ho er omsett til det valde språket), kan du endra språket som vert brukt i brukargrensesnittet på denne måten:" #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3163853\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - Language Settings - Languages." msgstr "Vis Verktøy → Innstillingar → $[officename]." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id121158\n" "help.text" msgid "Select another UI language in the \"User interface\" listbox." msgstr "Vel eit anna språk for brukargrensesnittet i lista «Brukargrensesnitt»." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3806878\n" "help.text" msgid "Click OK and restart the %PRODUCTNAME software." msgstr "Trykk «OK» og start %PRODUCTNAME på nytt." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id130619\n" "help.text" msgid "If the listbox doesn't list the language that you want, see \"Adding More UI Languages\"." msgstr "Viss språket du vil bruka ikkje finst i lista, sjå «Leggja til fleire språk for brukargrensesnitt»." #: language_select.xhp msgctxt "" "language_select.xhp\n" "hd_id9999694\n" "help.text" msgid "Adding More UI Languages" msgstr "Leggja til fleire språk for brukargrensesnittet" #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id9852901\n" "help.text" msgid "Close %PRODUCTNAME software (also close the Quickstarter, if you enabled it)." msgstr "Opna sprettoppmenyen og vel Rediger avsnittsstil for å opna dialogvindauget Avsnittsstil." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3791925\n" "help.text" msgid "Run %PRODUCTNAME installer, choose Modify, then select the language that you would like to install from the Additional user interface languages group." msgstr "Køyr installasjonsprogrammet for %PRODUCTNAME, vel «Endra» og vel deretter språket som du vil installera frå pakka «Fleire språk»." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id9852903\n" "help.text" msgid "If you use %PRODUCTNAME packages maintaned by your Linux distribution, follow the steps below." msgstr "Viss du brukar %PRODUCTNAME-pakkar frå Linuxdistribusjonen, følj stega nedanfor." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id9852902\n" "help.text" msgid "Close %PRODUCTNAME software (also close the Quickstarter, if you enabled it)." msgstr "Lukk %PRODUCTNAME (viss du har slått på snøggstart, bør du slå denne av)." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3791926\n" "help.text" msgid "Open your favourite package manager, look for %PRODUCTNAME language packs, and install the languages that you would like to use." msgstr "Opna den pakkehandteraren du likar best og sjå etter språkpakker for %PRODUCTNAME og installer språket du vil bruka." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id9852904\n" "help.text" msgid "If you downloaded %PRODUCTNAME packages from the main %PRODUCTNAME Web site, follow the steps below." msgstr "Viss du lasta ned %PRODUCTNAME-pakkar frå hovudnettstaden til %PRODUCTNAME, følj stega nedanfor." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id2216559\n" "help.text" msgid "Open your Web browser and enter http://www.libreoffice.org/download/" msgstr "Opna nettlesaren og skriv inn http://www.libreoffice.org/download/" #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id7869502\n" "help.text" msgid "Select and download the correct language pack for your version of %PRODUCTNAME software." msgstr "Vel og last ned den rette språkpakka for din versjon av %PRODUCTNAME." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id9852900\n" "help.text" msgid "Close %PRODUCTNAME software (also close the Quickstarter, if you enabled it)." msgstr "Lukk %PRODUCTNAME (viss du har slått på snøggstart, bør du slå denne av). " #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3791924\n" "help.text" msgid "Install the language pack. Unpack tar.gz file and install the packages according to standard practice on your platform." msgstr "Installer språkpakka. Pakk opp fila tar.gz og installer pakka slik som er vanleg praksis på plattforma du brukar." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id221655a\n" "help.text" msgid "Open your Web browser and enter http://www.libreoffice.org/download/" msgstr "Opna nettlesaren og skriv inn http://www.libreoffice.org/download/" #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id7869503\n" "help.text" msgid "Select and download the correct language pack for your version of %PRODUCTNAME software." msgstr "Vel og last ned den rette språkpakka for din versjon av %PRODUCTNAME." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id9852905\n" "help.text" msgid "Close %PRODUCTNAME software (also close the Quickstarter, if you enabled it)." msgstr "Lukk %PRODUCTNAME (viss du har slått på snøggstartaren, bør du slå han av)." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3791927\n" "help.text" msgid "Install the language pack by double-clicking the dmg file." msgstr "Installer språkpakka ved å dobbeltklikka på dmg-fila." #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3150043\n" "28\n" "help.text" msgid "%PRODUCTNAME - PreferencesTools - Options - Language Settings - Languages" msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Vis" #: language_select.xhp msgctxt "" "language_select.xhp\n" "par_id3152483\n" "29\n" "help.text" msgid "Format - Character - Font" msgstr "Format → Avsnitt → Kantlinjer" #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "tit\n" "help.text" msgid "Drawing Lines in Text" msgstr "Teikna linjer i tekst" #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "bm_id3143206\n" "help.text" msgid "arrows; drawing in textindicator lines in textlines; drawing in textlines; removing automatic linesdeleting; lines in textdrawing lines in textautomatic lines/borders in text" msgstr "piler; teikning i tekstindikatorlinjer i tekstlinjer; teikne i tekstlinjer; fjerna automatiske linjersletta; linjer i tekstteikne linjer i tekstautomatiske linjer/kantlinjer i tekst" #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "hd_id3143206\n" "36\n" "help.text" msgid "Drawing Lines in Text" msgstr "Teikna linjer i tekst" #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3144436\n" "37\n" "help.text" msgid "You can incorporate lines into your text with custom angles, width, color, and other attributes." msgstr "Du kan setja inn linjer i teksten og sjølv velja vinklar, breidd, farge og andre eigenskapar for desse." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3153345\n" "39\n" "help.text" msgid "To define the line attributes and direction, use the Line drawing object as follows:" msgstr "Du kan definera eigenskapar og retning for linjer ved å bruka teikneobjektet Linje slik:" #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3156113\n" "help.text" msgid "Icon" msgstr "Ikon" #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3152780\n" "help.text" msgid "Icon" msgstr "Ikon" #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3153254\n" "66\n" "help.text" msgid "1." msgstr "1." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3159400\n" "41\n" "help.text" msgid "On the Standard bar, click the Show Draw Functions icon to open the Drawing toolbar, and click the Line icon. The mouse pointer changes to a cross-hair symbol with a line beside it." msgstr "Trykk på Vis teiknefunksjonar på standardverktøylinja for å opna verktøylinja Teikning og trykk på knappen Linje. Musepeikaren vert endra til eit trådkors med ei linje ved sida." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3156117\n" "67\n" "help.text" msgid "2." msgstr "2." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3152472\n" "42\n" "help.text" msgid "In your document, click where the line should begin. Hold down the mouse button and drag to the point where you want the line to end. If you also hold down the Shift key, you can draw only horizontal, vertical, and diagonal lines." msgstr "Trykk i dokumentet du der du vil at linja skal byrja. Hald museknappen nede og dra til punktet der du vil at linja skal slutta. Viss du held nede «Skift» medan du dreg, kan du berre teikna vassrette, loddrette og diagonale linjer." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3149294\n" "help.text" msgid "Icon" msgstr "Ikon" #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3151056\n" "68\n" "help.text" msgid "3." msgstr "3." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3153361\n" "43\n" "help.text" msgid "Release the mouse button once the line has the desired direction and length. You can then draw more lines. End this function by pressing the Esc key or by clicking the Select icon from the Drawing bar." msgstr "Slepp museknappen når linja har retninga og lengda du ønskjer. Nå kan du teikne fleire linjer. Du kan avslutte denne funksjonen ved å trykka på «Escape»-tasten eller på knappen Vel på verktøylinja Teikning." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3156422\n" "69\n" "help.text" msgid "4." msgstr "4." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3159149\n" "44\n" "help.text" msgid "After clicking the Select icon, you can select all of the lines at the same time by clicking each line while holding down the Shift key. This multiple selection enables you to assign all of them a common color, width or other attribute." msgstr "Når du har trykt på knappen Vel, kan du merkja alle linjene samstundes ved å trykkja på kvar linje medan du held «Shift»-tasten nede. Når du merker eit utval på denne måten, kan du gje alle linjene ein felles farge, ei felles breidd eller andre eigenskapar." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3153049\n" "38\n" "help.text" msgid "Create a horizontal line by applying the preset Paragraph Style Horizontal Line. Click into an empty paragraph, and double-click the Horizontal Line Style in the Styles and Formatting window. If the entry for horizontal lines is not visible in the list of Paragraph Styles, select \"All Styles\" in the lower listbox." msgstr "Lag ei vassrett linje ved å bruka den førehandsdefinerte avsnittsstilen Vassrett linje. Set skrivemerket i eit tomt avsnitt og dobbeltklikk på stilen Vassrett linje i stilhandsamaren. Viss du ikkje ser oppføring for vassrette linjer i lista med avsnittsstilar, vel du «Alle stilar» i lista nederst i stilhandsamaren." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3153748\n" "64\n" "help.text" msgid "You can draw a line above, beside or below a paragraph in a Writer text document by choosing Format - Paragraph - Borders." msgstr "Du kan teikna ei linje over, ved sida av eller under eit avsnitt i eit Writer-tekstdokument ved å velja Format → Avsnitt → Kantlinjer." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_idN107C6\n" "help.text" msgid "Automatic lines in Writer" msgstr "Automatiske linjer i Writer" #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_idN107CC\n" "help.text" msgid "If you start a new line in a Writer text document by typing three or more hyphen characters and press the Enter key, the characters are removed and the previous paragraph gets a line as a bottom border." msgstr "Viss du byrjar ei ny linje i eit Writer-tekstdokument ved å skriva inn tre eller fleire bindestrekar og trykker Enter, vert teikna fjerna og det førre avsnittet får ei kantlinje nedst." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id8849452\n" "help.text" msgid "To create a single line, type three or more hyphens (-), or underscores ( _ ), and then press Enter. To create a double line, type three or more equal signs (=), asterisks (*), tildes (~), or hash marks (#), and then press Enter." msgstr "Du kan laga ei enkelt linje ved å skriva inn tre eller fleire bindestrekar (-) eller understrekar ( _ ) og så trykkja på «Enter». Hvis du vil setja inn ei dobbelt linje, skriv du inn tre eller fleire er likskaps-teikn (=), stjerner (*), tilde (~) eller nummerteikn (#) og så trykkjer på «Enter»." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_idN107D0\n" "help.text" msgid "To remove an automatically drawn border, choose Format - Paragraph - Borders and select no border." msgstr "For å fjerna ei automatisk teikna kantlinje, vel Format → Avsnitt → Kantlinjer og - Ingen -." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_idN107D8\n" "help.text" msgid "To undo an automatic border replacement once, choose Edit - Undo." msgstr "Viss du slettar ei kantlinje som er sett inn automatisk, men angrar slettinga, kan du få tilbake kantlinja ved å velja Rediger → Angra." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_idN107E0\n" "help.text" msgid "To disable the automatic borders, choose Tools - AutoCorrect Options - Options and clear Apply border." msgstr "For å slå av automatiske kantlinjer, vel Verktøy → Autoretting → Innstillingar og fjern Legg til kantlinje." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3145787\n" "45\n" "help.text" msgid "The lines and other drawing objects that you insert in text are not defined in HTML, and are therefore not exported directly into HTML format. Instead, they are exported as graphics." msgstr "Strekar og andre teikningar du set inn i tekst, vert ikkje definerte i HTML og vert difor heller ikkje eksporterte til formatet. I staden vert dei eksporterte som bilete." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id641804\n" "help.text" msgid "When you enter a line width, you can append a measurement unit. A zero line width results in a hairline with a width of one pixel of the output medium." msgstr "Når du skriv inn linjebreidd, kan du leggja til ei måleeining. Ei breidd på null gir ei hårfin linje med ei breidd på éin piksel i visinga og på utskrifter." #: line_intext.xhp msgctxt "" "line_intext.xhp\n" "par_id3154188\n" "65\n" "help.text" msgid "Format - Paragraph - Borders" msgstr "Format → Avsnitt → Kantlinjer" #: lineend_define.xhp msgctxt "" "lineend_define.xhp\n" "tit\n" "help.text" msgid "Defining Line Ends" msgstr "Definera linjesluttar" #: lineend_define.xhp msgctxt "" "lineend_define.xhp\n" "bm_id3146117\n" "help.text" msgid "defining; arrowheads and other line endsarrows; defining arrow headslines;defining ends" msgstr "definera; pilspissar og andre linjesluttarpiler; definera pilspissarlinjesluttar; definera" #: lineend_define.xhp msgctxt "" "lineend_define.xhp\n" "hd_id3146117\n" "14\n" "help.text" msgid "Defining Line Ends" msgstr "Definera linjesluttar" #: lineend_define.xhp msgctxt "" "lineend_define.xhp\n" "par_id3153750\n" "15\n" "help.text" msgid "You can define any object to be included in the list of available line ends." msgstr "Du kan definera og ta med kva objekt som helst i lista over tilgjengelege linjesluttar." #: lineend_define.xhp msgctxt "" "lineend_define.xhp\n" "par_id3147653\n" "16\n" "help.text" msgid "Use the draw functions to create an object to be used as a line end." msgstr "Bruk teiknefunksjonane til å laga eit objekt du vil bruka som linjeslutt." #: lineend_define.xhp msgctxt "" "lineend_define.xhp\n" "par_id3149795\n" "17\n" "help.text" msgid "Select the object and choose Format - Drawing Object - Graphic - Line." msgstr "Merk objektet og vel Format → Objekt → Bilete → Linje." #: lineend_define.xhp msgctxt "" "lineend_define.xhp\n" "par_id3154306\n" "18\n" "help.text" msgid "In the dialog, click the Arrow Styles." msgstr "Vel fana Pilstilar i dialogvindauget." #: lineend_define.xhp msgctxt "" "lineend_define.xhp\n" "par_id3149765\n" "19\n" "help.text" msgid "Click Add and assign a name to the new arrow style." msgstr "Trykk på Legg til og gje den nye pilstilen eit namn." #: lineend_define.xhp msgctxt "" "lineend_define.xhp\n" "par_id3151176\n" "20\n" "help.text" msgid "Click OK to close the dialog." msgstr "Trykk på OK for å lukka dialogvindauget." #: linestyle_define.xhp msgctxt "" "linestyle_define.xhp\n" "tit\n" "help.text" msgid "Defining Line Styles" msgstr "Definera linjestilar" #: linestyle_define.xhp msgctxt "" "linestyle_define.xhp\n" "bm_id3153825\n" "help.text" msgid "line styles;definingdefining;line styles" msgstr "linjestilar; veljavelja; linjestilar" #: linestyle_define.xhp msgctxt "" "linestyle_define.xhp\n" "hd_id3153825\n" "9\n" "help.text" msgid "Defining Line Styles" msgstr "Definera linjestilar" #: linestyle_define.xhp msgctxt "" "linestyle_define.xhp\n" "par_id3153880\n" "10\n" "help.text" msgid "Select a line drawing object in a document." msgstr "Merk eit linjeteikneobjekt i eit dokument." #: linestyle_define.xhp msgctxt "" "linestyle_define.xhp\n" "par_id3155419\n" "14\n" "help.text" msgid "Choose Format - Drawing Object - Graphic - Line and click the Line Styles tab." msgstr "Vel Format → ObjektBilete → Linje og trykk på fana Linje tab." #: linestyle_define.xhp msgctxt "" "linestyle_define.xhp\n" "par_id3155449\n" "15\n" "help.text" msgid "Specify the line options that you want." msgstr "Vel innstillingane du vil bruka for linja." #: linestyle_define.xhp msgctxt "" "linestyle_define.xhp\n" "par_id3150791\n" "16\n" "help.text" msgid "To specify the length of the line as a percentage of the line width, select Fit to line width." msgstr "Du kan angje lengda på linja som ein prosentdel av linjebreidda ved å merka av for Tilpass til linjebreidda." #: linestyle_define.xhp msgctxt "" "linestyle_define.xhp\n" "par_id3152920\n" "12\n" "help.text" msgid "Click Add." msgstr "Trykk OK." #: linestyle_define.xhp msgctxt "" "linestyle_define.xhp\n" "par_id3145606\n" "17\n" "help.text" msgid "Enter a name for the line style and click OK." msgstr "Skriv inn eit namn på linjestilen og trykk på OK." #: linestyle_define.xhp msgctxt "" "linestyle_define.xhp\n" "par_id3149202\n" "13\n" "help.text" msgid "To save the line style in a custom line style list, click the Save Line Styles icon." msgstr "Viss du vil lagra linjestilen i ei liste over eigne linjestilar, kan du trykkja på knappen Lagra linjestilar." #: linestyle_define.xhp msgctxt "" "linestyle_define.xhp\n" "par_idN10671\n" "help.text" msgid "Click Close to close the dialog." msgstr "Trykk på Lukk for å lukka dialogvindauget." #: linestyles.xhp msgctxt "" "linestyles.xhp\n" "tit\n" "help.text" msgid "Applying Line Styles" msgstr "Bruka linjestilar" #: linestyles.xhp msgctxt "" "linestyles.xhp\n" "bm_id3153884\n" "help.text" msgid "separator lines; definingreference linesarrows; defining arrow linesline styles; applying" msgstr "skiljelinjer; definisjonreferanselinjerpiler; velja pillinjerlinjestilar; bruka" #: linestyles.xhp msgctxt "" "linestyles.xhp\n" "hd_id3153884\n" "3\n" "help.text" msgid "Applying Line Styles Using the Toolbar" msgstr "Bruka linjestilar ved hjelp av verktøylinja" #: linestyles.xhp msgctxt "" "linestyles.xhp\n" "par_id3150669\n" "5\n" "help.text" msgid "The Drawing Object Properties toolbar contains icons and combo boxes to define various line attributes." msgstr "Verktøylinja Eigenskapar for teikneobjekt inneheld knappar og kombinasjonsboksar du kan bruke til å bestemma ulike linjeeigenskapar." #: linestyles.xhp msgctxt "" "linestyles.xhp\n" "par_id3145068\n" "6\n" "help.text" msgid "Click the Line icon Icon to open the Line dialog." msgstr "Trykk på knappen Linje Ikon for å opna dialogvindauget Linje." #: linestyles.xhp msgctxt "" "linestyles.xhp\n" "par_idN106D6\n" "help.text" msgid "Click the Arrow Styles icon Icon to select an arrow style for the right and left ends of a line." msgstr "Trykk på knappen Pilstil Ikon for å velja ein pilstil for venstre og høgre linjeslutt." #: linestyles.xhp msgctxt "" "linestyles.xhp\n" "par_id3150868\n" "7\n" "help.text" msgid "Select a style from the Line Style box and specify the width in the Line Width box. A width of 0 corresponds to 1 pixel." msgstr "Vel ein stil frå boksen Linjestil og vel breidda i boksen Linjebreidde. Ei breidde på 0 svarar til 1 piksel." #: linestyles.xhp msgctxt "" "linestyles.xhp\n" "par_idN1070A\n" "help.text" msgid "Select the line and arrow color in the Line Color box." msgstr "Vel linje- og pilfargen du vil bruka i boksen Linjefarge." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "tit\n" "help.text" msgid "Recording a Macro" msgstr "Opptak av makro" #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "bm_id3093440\n" "help.text" msgid "macros; recordingrecording; macrosBasic; recording macros" msgstr "makroar; ta oppta opp; makroarBasic; ta opp makroar" #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "hd_id3093440\n" "1\n" "help.text" msgid "Recording a Macro" msgstr "Opptak av makro" #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3154749\n" "4\n" "help.text" msgid "Open the document for which you want to record a macro." msgstr "Opna dokumentet du vil ta opp ein makro for." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3149398\n" "5\n" "help.text" msgid "Choose Tools - Macros - Record Macro." msgstr "Vel Verktøy → Makroar → Opptak av makro" #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3149399\n" "help.text" msgid "If Tools - Macros - Record Macro menu item is missing, make sure that macro recording feature is enabled in %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME - Advanced." msgstr "Viss menyvalet Verktøy → Makroar → Opptak av makro manglar, sjå etter at opptak av makroar er slått på i %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → %PRODUCTNAME → Avansert." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3150275\n" "6\n" "help.text" msgid "You see the small Recording dialog with just one button called Stop Recording." msgstr "Du vil nå sjå det vesle dialogvindauget Opptak av makro som har ein einaste knapp: Stopp opptak." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3153087\n" "7\n" "help.text" msgid "Perform the actions you want to be recorded in the document." msgstr "Utfør handlingane du vil ha med i makroen. " #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3150504\n" "15\n" "help.text" msgid "Press the Escape key to deselect an object, as the macro recorder currently does not record this action by mouse click." msgstr "Trykk på «Escape»-tasten viss du vil oppheva merkinga av eit objekt fordi opptaksfunksjonen for makroar for tida ikkje kan ta opp denne handlinga når ho vert utført med museklikk." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3148492\n" "8\n" "help.text" msgid "Click Stop Recording." msgstr "Trykk på Stopp opptak." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3148686\n" "9\n" "help.text" msgid "The Macro dialog appears, in which you can save and run the macro." msgstr "Dialogvindauget Makro vert opna. Her kan du lagra og køyra makroen." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3159158\n" "10\n" "help.text" msgid "If you want to abort the recording without saving a macro, click the Close button of the Recording dialog." msgstr "Viss du vil avbryta opptaket utan å lagra ein makro, kan du trykka på Lukk i dialogvindauget Opptak av makro." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3144510\n" "11\n" "help.text" msgid "To save the macro, first select the object where you want the macro to be saved in the Save macro in list box." msgstr "Når du skal lagra makroen, må du først velja objektet der du vil lagra makroen, under Lagra makroen i." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3148550\n" "12\n" "help.text" msgid "If you want the macro to be saved into a new library or module, click the New Library or New Module button and enter a name for the library or module." msgstr "Viss du vil lagra makroen i eit nytt bibliotek eller i ein ny modul, trykk på Nytt bibliotek eller Ny modul og skriv inn eit namn på biblioteket eller modulen." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3149456\n" "13\n" "help.text" msgid "Enter a name for the new macro in the Macro name text box. Do not use Basic keywords as a name." msgstr "Skriv inn eit namn på den nye makroen i tekstfeltetMakronamn. Ikkje bruk nøkkelord frå Basic som namn." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3154138\n" "14\n" "help.text" msgid "Click Save." msgstr "Trykk OK." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "hd_id2486342\n" "help.text" msgid "Limitations of the macro recorder" msgstr "Avgrensingar for makroopptakaren" #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3608508\n" "help.text" msgid "The following actions are not recorded:" msgstr "Desse handlingane vert ikkje tekne opp:" #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id921353\n" "help.text" msgid "Opening of windows is not recorded." msgstr "Opning av vindauge vert ikkje registrert." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id9296243\n" "help.text" msgid "Actions carried out in another window than where the recorder was started are not recorded." msgstr "Handlingar som vert utførte i andre vindauge enn vindauget der opptakaren vart starta, vert ikkje tatt opp." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id4269234\n" "help.text" msgid "Window switching is not recorded." msgstr "Byte av vindauge vert ikkje registrert." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id8014465\n" "help.text" msgid "Actions that are not related to the document contents are not recorded. For example, changes made in the Options dialog, macro organizer, customizing." msgstr "Handlingar som ikkje er knytt til innhaldet i dokumentet vert ikkje tatt opp. Eksempel på slike handlingar er endringar i dialogvindauget «Innstillingar», organisering av makroar og tilpasingar." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id2814416\n" "help.text" msgid "Selections are recorded only if they are done by using the keyboard (cursor traveling), but not when the mouse is used." msgstr "Utval vert berre tatt opp viss dei vert gjort ved hjelp av tastaturet (markørflytting), men ikkje når musa vert brukt." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id2522354\n" "help.text" msgid "The macro recorder works only in Calc and Writer." msgstr "Makroopptakaren verkar berre i Calc og Writer." #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3156422\n" "help.text" msgid "Macro" msgstr "Ark" #: macro_recording.xhp msgctxt "" "macro_recording.xhp\n" "par_id3147576\n" "2\n" "help.text" msgid "Programming in %PRODUCTNAME" msgstr "Programmera i %PRODUCTNAME" #: main.xhp msgctxt "" "main.xhp\n" "tit\n" "help.text" msgid "General Instructions for %PRODUCTNAME" msgstr "Generelle rettleiingar for %PRODUCTNAME" #: main.xhp msgctxt "" "main.xhp\n" "bm_id3151097\n" "help.text" msgid "instructions; general" msgstr "instruksjon; genereltrettleiing; generelt" #: main.xhp msgctxt "" "main.xhp\n" "hd_id3151097\n" "1\n" "help.text" msgid "General Instructions for %PRODUCTNAME" msgstr "Generelle rettleiingar for %PRODUCTNAME" #: main.xhp msgctxt "" "main.xhp\n" "hd_id3153681\n" "2\n" "help.text" msgid "Opening and Saving Documents and Templates" msgstr "Opna og lagra dokument og malar" #: main.xhp msgctxt "" "main.xhp\n" "hd_id3150669\n" "3\n" "help.text" msgid "Using Windows, Menus and Icons" msgstr "Bruka vindauge, menyar og knappar" #: main.xhp msgctxt "" "main.xhp\n" "hd_id3149295\n" "10\n" "help.text" msgid "Accessibility" msgstr "Tilgjenge" #: main.xhp msgctxt "" "main.xhp\n" "hd_id3159149\n" "4\n" "help.text" msgid "Copying Data by Drag and Drop or Menu Commands" msgstr "Kopiera data ved hjelp av dra og slepp eller menykommandoar" #: main.xhp msgctxt "" "main.xhp\n" "hd_id3152576\n" "5\n" "help.text" msgid "Data Sources" msgstr "Datakjelder" #: main.xhp msgctxt "" "main.xhp\n" "par_idN10826\n" "help.text" msgid "Working with databases in %PRODUCTNAME" msgstr "Arbeida med databasar i %PRODUCTNAME" #: main.xhp msgctxt "" "main.xhp\n" "par_idN10841\n" "help.text" msgid "Table Wizard" msgstr "Tabellvegvisar" #: main.xhp msgctxt "" "main.xhp\n" "par_idN1085B\n" "help.text" msgid "Query Wizard" msgstr "Spørjingsvegvisar" #: main.xhp msgctxt "" "main.xhp\n" "par_idN10875\n" "help.text" msgid "Forms Wizard" msgstr "Skjemavegvisar" #: main.xhp msgctxt "" "main.xhp\n" "par_id3154011\n" "12\n" "help.text" msgid "Report Wizard" msgstr "Rapportvegvisar" #: main.xhp msgctxt "" "main.xhp\n" "hd_id3147216\n" "6\n" "help.text" msgid "Recording Changes (Revision Marking)" msgstr "Ta opp endringar (revisjonsmerking)" #: main.xhp msgctxt "" "main.xhp\n" "hd_id3145261\n" "7\n" "help.text" msgid "Configuring and Modifying %PRODUCTNAME" msgstr "Setja opp og endra %PRODUCTNAME" #: main.xhp msgctxt "" "main.xhp\n" "hd_id3145252\n" "8\n" "help.text" msgid "Charts" msgstr "Diagram" #: main.xhp msgctxt "" "main.xhp\n" "hd_id3157846\n" "9\n" "help.text" msgid "Miscellaneous" msgstr "Ymse" #: main.xhp msgctxt "" "main.xhp\n" "par_id3147173\n" "13\n" "help.text" msgid "General Terminology" msgstr "Generelle uttrykk" #: main.xhp msgctxt "" "main.xhp\n" "par_id3156332\n" "14\n" "help.text" msgid "Internet Terminology" msgstr "Internett-uttrykk" #: measurement_units.xhp msgctxt "" "measurement_units.xhp\n" "tit\n" "help.text" msgid "Selecting Measurement Units" msgstr "Velja måleeiningar" #: measurement_units.xhp msgctxt "" "measurement_units.xhp\n" "bm_id3159201\n" "help.text" msgid "documents;measurement units inmeasurement units;selectingunits;measurement unitscentimetersinchesdistancesselecting;measurement units" msgstr "dokument;måleeiningar imåleeiningar;veljaeiningar;måleeiningarcentimetertommaravstandervelja;måleeiningar" #: measurement_units.xhp msgctxt "" "measurement_units.xhp\n" "hd_id3159201\n" "help.text" msgid "Selecting Measurement Units" msgstr "Velja måleeiningar" #: measurement_units.xhp msgctxt "" "measurement_units.xhp\n" "par_id3146957\n" "2\n" "help.text" msgid "You can select separate measurement units for $[officename] Writer, $[officename] Writer/Web, $[officename] Calc, $[officename] Impress and $[officename] Draw documents." msgstr "Du kan velja separate måleeiningar for dokument i $[officename] Writer-, $[officename] Writer/Web, $[officename] Calc, $[officename] Impress og $[officename] Draw." #: measurement_units.xhp msgctxt "" "measurement_units.xhp\n" "par_idN10674\n" "help.text" msgid "Open a document of the type for which you want to change the measurement units." msgstr "Opna eit dokument av den typen du vil byta måleeiningar for." #: measurement_units.xhp msgctxt "" "measurement_units.xhp\n" "par_id3153345\n" "3\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options." msgstr "Vis Verktøy → Innstillingar → $[officename]." #: measurement_units.xhp msgctxt "" "measurement_units.xhp\n" "par_id3154749\n" "4\n" "help.text" msgid "In the left pane of the dialog, double-click the application for which you want to select the measurement unit." msgstr "Dobbeltklikk på programmet du vil velja måleeining for i det venstre panelet i dialogvindauget." #: measurement_units.xhp msgctxt "" "measurement_units.xhp\n" "par_id3147653\n" "5\n" "help.text" msgid "Double-click %PRODUCTNAME Writer if you want to select the measurement units for text documents." msgstr "Dobbeltklikk på %PRODUCTNAME Writer viss du vil velja måleeiningar for tekstdokument." #: measurement_units.xhp msgctxt "" "measurement_units.xhp\n" "par_id3150443\n" "6\n" "help.text" msgid "Click on General." msgstr "Trykk på Generelt." #: measurement_units.xhp msgctxt "" "measurement_units.xhp\n" "par_id3147335\n" "7\n" "help.text" msgid "On the General tab page, select the measurement unit. Close the dialog with OK." msgstr "Vel måleeininga på fana Generelt. Lukk dialogvindauget med OK." #: measurement_units.xhp msgctxt "" "measurement_units.xhp\n" "par_id3153126\n" "8\n" "help.text" msgid "Entering measurement units directly" msgstr "Skriva inn måleeiningar direkte" #: measurement_units.xhp msgctxt "" "measurement_units.xhp\n" "par_id3148473\n" "9\n" "help.text" msgid "%PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME Writer - General" msgstr "Verktøy → Innstillingar → %PRODUCTNAME → Vis" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "tit\n" "help.text" msgid "Comparing Microsoft Office and $[officename] Terms" msgstr "Samanlikning av termar i Microsoft Office og $[officename]" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "bm_id3156136\n" "help.text" msgid "Microsoft Office;feature comparisons" msgstr "Microsoft Office;samanlikning av funksjonar" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "hd_id3156136\n" "50\n" "help.text" msgid "Comparing Microsoft Office and $[officename] Terms" msgstr "Samanlikning av termar i Microsoft Office og $[officename]" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3149177\n" "1\n" "help.text" msgid "The following table lists Microsoft Office features and their $[officename] equivalents." msgstr "Denne tabellen viser ei liste over funksjonar i Microsoft Office XP og dei tilsvarande funksjonane i $[officename]." #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3153748\n" "2\n" "help.text" msgid "Microsoft Office XP" msgstr "Microsoft Office XP" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3156346\n" "3\n" "help.text" msgid "$[officename]" msgstr "$[officename]" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3153252\n" "4\n" "help.text" msgid "AutoShapes" msgstr "Autofigurar" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3154897\n" "5\n" "help.text" msgid "Gallery Objects
Shapes are on the Drawing toolbar (menu View - Toolbars - Drawing)" msgstr "Galleriobjekt
Du finn figurane på verktøylinja Teikning (menyen Vis → Verktøylinjer → Teikning)" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3157910\n" "6\n" "help.text" msgid "Change Case" msgstr "Byt store og små bokstavar" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3153825\n" "7\n" "help.text" msgid "Case/Characters" msgstr "Store og små teikn" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id1029200801240915\n" "help.text" msgid "Click and Type" msgstr "Klikk og skriv" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id1029200801240965\n" "help.text" msgid "Direct Cursor" msgstr "Direkte skrivemerke" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3148946\n" "10\n" "help.text" msgid "Compare and Merge Documents" msgstr "Samanlikna og fletta dokument" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3153524\n" "11\n" "help.text" msgid "Compare" msgstr "Samanlikn" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3151041\n" "12\n" "help.text" msgid "Document Map" msgstr "Dokumentstruktur" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3156280\n" "13\n" "help.text" msgid "Navigator" msgstr "Struktur" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3153768\n" "14\n" "help.text" msgid "Formula Auditing" msgstr "Formelrevisjon" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3154013\n" "15\n" "help.text" msgid "Detective" msgstr "Sporing" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3153573\n" "16\n" "help.text" msgid "Lines and Page Breaks" msgstr "Linje- og sidebryting" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3151116\n" "17\n" "help.text" msgid "Text Flow" msgstr "Tekstflyt" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id6054567\n" "help.text" msgid "Page setup" msgstr "Sideoppsett" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id8584551\n" "help.text" msgid "Format - Page" msgstr "Format → Side" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id0522200809491254\n" "help.text" msgid "For spreadsheets see also View - Page Break Preview" msgstr "Sjå også Vis → Førehandsvising av sideskift for rekneark." #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3159153\n" "18\n" "help.text" msgid "Mail Merge" msgstr "Brevfletting" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3145748\n" "19\n" "help.text" msgid "Form Letter" msgstr "Standardbrev" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3152940\n" "20\n" "help.text" msgid "Markup" msgstr "Oppmerking" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3147048\n" "21\n" "help.text" msgid "Track Changes - Show Changes" msgstr "Endringar → Vis endringar" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3153950\n" "26\n" "help.text" msgid "Refresh Data (in Excel)" msgstr "Oppdater data (i Excel)" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id4526200\n" "help.text" msgid "Refresh Range" msgstr "Oppdater område" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3145643\n" "28\n" "help.text" msgid "Replace text as you type" msgstr "Byt ut tekst medan du skriv" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3152962\n" "29\n" "help.text" msgid "AutoCorrect" msgstr "Autoretting" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3154755\n" "30\n" "help.text" msgid "Show/Hide" msgstr "Vis/Gøym" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3150045\n" "31\n" "help.text" msgid "Nonprinting Characters, Hidden Paragraphs" msgstr "Kontrollteikn, Gøymde avsnitt" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3156373\n" "34\n" "help.text" msgid "Spelling and Grammar" msgstr "Stave- og grammatikkontroll" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3150297\n" "35\n" "help.text" msgid "Spellcheck" msgstr "Stavekontroll" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3154205\n" "38\n" "help.text" msgid "Track changes" msgstr "Spor endringar" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3146810\n" "39\n" "help.text" msgid "Changes - Record" msgstr "Endringar → Start opptak" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3151214\n" "40\n" "help.text" msgid "Validation" msgstr "Validering" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3156138\n" "41\n" "help.text" msgid "Validity" msgstr "Gyldigheit" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3166431\n" "46\n" "help.text" msgid "Workbook" msgstr "Arbeidsbok" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3155379\n" "47\n" "help.text" msgid "Spreadsheet" msgstr "Rekneark" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3153228\n" "48\n" "help.text" msgid "Worksheet" msgstr "Arbeidsark" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id3148593\n" "49\n" "help.text" msgid "Sheet" msgstr "Ark" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id0522200809491330\n" "help.text" msgid "Shared Workbooks" msgstr "Delte arbeidsbøker" #: microsoft_terms.xhp msgctxt "" "microsoft_terms.xhp\n" "par_id0522200809491320\n" "help.text" msgid "Collaboration" msgstr "Samarbeid" #: ms_doctypes.xhp msgctxt "" "ms_doctypes.xhp\n" "tit\n" "help.text" msgid "Changing the Association of Microsoft Office Document Types" msgstr "Endra filtilknyting for Microsoft Office-dokumenttypar" #: ms_doctypes.xhp msgctxt "" "ms_doctypes.xhp\n" "bm_id3143267\n" "help.text" msgid "Microsoft Office;reassigning document typesfile associations for Microsoft Officechanging;file associations in Setup program" msgstr "Microsoft Office;tilordna dokumenttypar på nyttfiltilknyting for Microsoft Officeendra; filtilknyting i oppsettsprogrammet" #: ms_doctypes.xhp msgctxt "" "ms_doctypes.xhp\n" "hd_id3143267\n" "8\n" "help.text" msgid "Changing the Association of Microsoft Office Document Types" msgstr "Endra filtilknyting for Microsoft Office-dokumenttypar" #: ms_doctypes.xhp msgctxt "" "ms_doctypes.xhp\n" "par_id3152780\n" "1\n" "help.text" msgid "To change the association of Microsoft Office file name extensions to open the files either in $[officename] or in Microsoft Office, using Microsoft Windows:" msgstr "For å endra filtilknytinga for Microsoft Office-filetternamn slik at filene vert opna anten i $[officename] eller i Microsoft Office, bruk Microsoft Windows:" #: ms_doctypes.xhp msgctxt "" "ms_doctypes.xhp\n" "par_id0815200803314147\n" "help.text" msgid "In Windows Explorer, right-click a file of the type that you want to assign to another application." msgstr "I Windows utforskar, høgreklikk ei fil av typen du vil knyta til eit anna program." #: ms_doctypes.xhp msgctxt "" "ms_doctypes.xhp\n" "par_id0815200803314268\n" "help.text" msgid "In the context menu, choose \"Open with...\"" msgstr "I sprettoppmenyen, vel «Opna med …»" #: ms_doctypes.xhp msgctxt "" "ms_doctypes.xhp\n" "par_id0815200803314245\n" "help.text" msgid "In the list of applications, select the program that should open the current type of files. Make sure that \"Always use this program\" is selected." msgstr "Merk i programlista programmet som den gjeldande filtypen skal opnast i. Sjå etter at «Bruk alltid dette programmet» er merkt." #: ms_doctypes.xhp msgctxt "" "ms_doctypes.xhp\n" "par_id0815200803314243\n" "help.text" msgid "If these steps do not apply to your brand of Microsoft Windows, search your Microsoft Windows Help for instructions how to change the file associations." msgstr "Viss desse stega ikkje passar for den versjonen av Microsoft Windows som du brukar, søk gjennom Hjelp for å finna ut korleis filtilordningar kan endrast." #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "tit\n" "help.text" msgid "About Converting Microsoft Office Documents" msgstr "Om konvertering av Microsoft Office-dokument" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "bm_id3149760\n" "help.text" msgid "Microsoft Office;document import restrictions import restrictions for Microsoft Office Microsoft Office;importing password protected files" msgstr "Microsoft Office;avgrensingar ved import av dokumentimportavgrensingar for Microsoft OfficeMicrosoft Office; import av filer med passord" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "hd_id3152425\n" "1\n" "help.text" msgid "About Converting Microsoft Office Documents" msgstr "Om konvertering av Microsoft Office-dokument" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3147834\n" "2\n" "help.text" msgid "$[officename] can automatically open Microsoft Office 97/2000/XP documents. However, some layout features and formatting attributes in more complex Microsoft Office documents are handled differently in $[officename] or are unsupported. As a result, converted files require some degree of manual reformatting. The amount of reformatting that can be expected is proportional to the complexity of the structure and formatting of the source document. $[officename] cannot run Visual Basic Scripts, but can load them for you to analyze." msgstr "$[officename] kan opna dokument frå Microsoft Office 97/2000/XP automatisk. Enkelte eigenskapar for utforming og formatering i meir komplekse Microsoft Office-dokument vert handterte annleis i $[officename] eller vert ikkje støtta. Dette kan føra til at dei konverterte filene må omformaterast manuelt. Kor mykje omformatering som ein må rekna med veks proporsjonalt med kor kompleks strukturen og formateringa er i det opphavlege dokumentet. $[officename] kan ikkje køyra Visual Basic-skript, men kan lasta dei ned og visa dei." #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id0804200804174819\n" "help.text" msgid "The most recent versions of %PRODUCTNAME can load and save the Microsoft Office Open XML document formats with the extensions docx, xlsx, and pptx. The same versions can also run some Excel Visual Basic scripts, if you enable this feature at %PRODUCTNAME - PreferencesTools - Options - Load/Save - VBA Properties." msgstr "Dei seinaste versionane av %PRODUCTNAME kan henta inn og lagra dokumentformata Microsoft Office XML av filtyperna docx, xlsx og pptx. Dei same versjonane kan også køyra nokre Excel Visual Basic-skript viss du aktiverer denne funksjonen med %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → Opna/lagra → VBA-eigenskaper." #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3155934\n" "3\n" "help.text" msgid "The following lists provide a general overview of Microsoft Office features that may cause conversion challenges. These will not affect your ability to use or work with the content of the converted document." msgstr "Dei følgjande listene viser eit oversyn over Microsoft Office-funksjonar som kan laga konverteringsproblem. Dette påverkar ikkje eit mogleg arbeid med innhaldet i det konverterte dokumentet." #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "hd_id3155892\n" "6\n" "help.text" msgid "Microsoft Word" msgstr "Microsoft Word" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3147088\n" "7\n" "help.text" msgid "AutoShapes" msgstr "Autofigurar" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3150774\n" "8\n" "help.text" msgid "Revision marks" msgstr "Revisjonsmerke" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3147209\n" "9\n" "help.text" msgid "OLE objects" msgstr "OLE-objekt" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3154749\n" "10\n" "help.text" msgid "Certain controls and Microsoft Office form fields" msgstr "Visse kontrollelement og Microsoft Office-skjemafelt" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3149578\n" "11\n" "help.text" msgid "Indexes" msgstr "Register" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3155342\n" "12\n" "help.text" msgid "Tables, frames, and multi-column formatting" msgstr "Tabellar, rammer og formatering av fleire kolonnar" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3153541\n" "13\n" "help.text" msgid "Hyperlinks and bookmarks" msgstr "Hyperlenkjer og bokmerke" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3154143\n" "14\n" "help.text" msgid "Microsoft WordArt graphics" msgstr "Microsoft WordArt-grafikk" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3156117\n" "15\n" "help.text" msgid "Animated characters/text" msgstr "Animert teikn/tekst" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "hd_id3153524\n" "24\n" "help.text" msgid "Microsoft PowerPoint" msgstr "Microsoft PowerPoint" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3154365\n" "25\n" "help.text" msgid "AutoShapes" msgstr "Autofigurar" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3156424\n" "26\n" "help.text" msgid "Tab, line, and paragraph spacing" msgstr "Tabulator, linje- og avsnittsavstand" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3154910\n" "27\n" "help.text" msgid "Master background graphics" msgstr "Master bakgrunnsbilete" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3159151\n" "28\n" "help.text" msgid "Grouped objects" msgstr "Grupperte objekt" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3156282\n" "29\n" "help.text" msgid "Certain multimedia effects" msgstr "Visse multimediaeffektar" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "hd_id3150986\n" "16\n" "help.text" msgid "Microsoft Excel" msgstr "Microsoft Excel" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3148685\n" "17\n" "help.text" msgid "AutoShapes" msgstr "Autofigurar" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3149514\n" "18\n" "help.text" msgid "OLE objects" msgstr "OLE-objekt" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3148943\n" "19\n" "help.text" msgid "Certain controls and Microsoft Office form fields" msgstr "Visse kontrollelement og Microsoft Office-skjemafelt" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3155922\n" "20\n" "help.text" msgid "Pivot tables" msgstr "Pivottabellar" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3152361\n" "21\n" "help.text" msgid "New chart types" msgstr "Nye diagramtypar" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3156343\n" "22\n" "help.text" msgid "Conditional formatting" msgstr "Vilkårsformatering" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3149456\n" "23\n" "help.text" msgid "Some functions/formulas (see below)" msgstr "Nokre funksjonar/formlar (sjå nedanfor)" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id0811200801491971\n" "help.text" msgid "One example of differences between Calc and Excel is the handling of boolean values. Enter TRUE to cells A1 and A2." msgstr "Eit eksempel på skilnadane mellom Calc og Excel er handtringa av logiske verdiar. Skriv SANN i cellene A1 og A2." #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id0811200801491973\n" "help.text" msgid "In Calc, the formula =A1+A2 returns the value 2, and the formula =SUM(A1;A2) returns 2." msgstr "I Calc returnerer formelen «=A1+A2» verdien 2 og formelen «=SUMMER(A1;A2)» returnerer 2." #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id0811200801491972\n" "help.text" msgid "In Excel, the formula =A1+A2 returns 2, but the formula =SUM(A1,A2) returns 0." msgstr "I Excel returnerer formelen «=A1+A2» verdien 2 medan formelen «=SUMMER(A1;A2)» returnerer 0." #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3150439\n" "30\n" "help.text" msgid "For a detailed overview about converting documents to and from Microsoft Office format, see the Migration Guide." msgstr "Du kan finna eit detaljert oversyn over konvertering av dokument til og frå Microsoft Office-format på Migration Guide." #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10A9F\n" "help.text" msgid "Opening Microsoft Office Documents That Are Protected With a Password" msgstr "Opna Microsoft Office-dokument som er verna med passord" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id8699606\n" "help.text" msgid "%PRODUCTNAME can open the following Microsoft Office document types that are protected by a password." msgstr "%PRODUCTNAME kan opna desse Microsoft Office-dokumenttypane som er verna med eit passord." #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10AB6\n" "help.text" msgid "Microsoft Office format" msgstr "Microsoft Office-format" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10ABC\n" "help.text" msgid "Supported encryption method" msgstr "Krypteringsmetode som har støtte" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10AC3\n" "help.text" msgid "Word 6.0, Word 95" msgstr "Word 6.0, Word 95" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10AC9\n" "help.text" msgid "Weak XOR encryption" msgstr "Svak XOR-kryptering" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10AD0\n" "help.text" msgid "Word 97, Word 2000, Word XP, Word 2003" msgstr "Word 97, Word 2000, Word XP, Word 2003" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10AD6\n" "help.text" msgid "Office 97/2000 compatible encryption" msgstr "Office 97/2000-kompatibel kryptering" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10ADD\n" "help.text" msgid "Word XP, Word 2003" msgstr "Word XP, Word 2003" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10AE3\n" "help.text" msgid "Weak XOR encryption from older Word versions" msgstr "Svak XOR-kryptering frå eldre versjonar av Word" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10AEA\n" "help.text" msgid "Excel 2.1, Excel 3.0, Excel 4.0, Excel 5.0, Excel 95" msgstr "Excel 2.1, Excel 3.0, Excel 4.0, Excel 5.0, Excel 95" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10AF0\n" "help.text" msgid "Weak XOR encryption" msgstr "Svak XOR-kryptering" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10AF7\n" "help.text" msgid "Excel 97, Excel 2000, Excel XP, Excel 2003" msgstr "Excel 97, Excel 2000, Excel XP, Excel 2003" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10AFD\n" "help.text" msgid "Office 97/2000 compatible encryption" msgstr "Office 97/2000-kompatibel kryptering" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10B04\n" "help.text" msgid "Excel XP, Excel 2003" msgstr "Excel XP, Excel 2003" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10B0A\n" "help.text" msgid "Weak XOR encryption from older Excel versions" msgstr "Svak XOR-kryptering frå eldre versjonar av Excel" #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_idN10B0D\n" "help.text" msgid "Microsoft Office files that are encrypted by AES128 can be opened. Other encryption methods are not supported." msgstr "Microsoft Office-filer som er krypterte med AES128, kan opnast. Andre krypteringsmetodar er ikkje støtta." #: ms_import_export_limitations.xhp msgctxt "" "ms_import_export_limitations.xhp\n" "par_id3147318\n" "33\n" "help.text" msgid "Setting the default file format" msgstr "Vel standard filformat" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "tit\n" "help.text" msgid "Using Microsoft Office and $[officename]" msgstr "Bruka Microsoft Office og $[officename]" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "bm_id3150789\n" "help.text" msgid "Office;Microsoft Office and $[officename]Microsoft Office;new users informationopening;Microsoft Office filessaving;in Microsoft Office file formatmacros; in MS Office documents" msgstr "Office;Microsoft Office og $[officename]Microsoft Office;informasjon for nye brukararopna;Microsoft Office-filerlagra;i Microsoft Office-filformatmakroar; i MS Office-dokument" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "hd_id3150789\n" "30\n" "help.text" msgid "Using Microsoft Office and $[officename]" msgstr "Bruka Microsoft Office og $[officename]" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3152801\n" "1\n" "help.text" msgid "$[officename] can open and save documents in the Microsoft Office file formats, including Microsoft Office Open XML formats." msgstr "$[officename] kan opna og lagra dokument i Microsoft Office-filformata, inklusive Microsoft Office Open XML-formata." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "hd_id3145345\n" "2\n" "help.text" msgid "Opening a Microsoft Office File" msgstr "Opna ei Microsoft Office-fil" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3147008\n" "3\n" "help.text" msgid "Choose File - Open. Select a Microsoft Office file in the $[officename] file open dialog." msgstr "Vel Fil → Opna. Vel ei Microsoft Office-fil i dialogvindauget for opning av filer i $[officename]." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3156346\n" "4\n" "help.text" msgid "MS Office file..." msgstr "MS Office-fil …" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3155342\n" "5\n" "help.text" msgid "...will open in $[officename] module" msgstr "… vert opna i $[officename]-modulen" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3153543\n" "6\n" "help.text" msgid "MS Word, *.doc, *.docx" msgstr "MS Word, *.doc, *.docx" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3147620\n" "7\n" "help.text" msgid "$[officename] Writer" msgstr "$[officename] Writer" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3154898\n" "8\n" "help.text" msgid "MS Excel, *.xls, *.xlsx" msgstr "MS Excel, *.xls, *.xlsx" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3149580\n" "9\n" "help.text" msgid "$[officename] Calc" msgstr "$[officename] Calc" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3147574\n" "10\n" "help.text" msgid "MS PowerPoint, *.ppt, *.pps, *.pptx" msgstr "MS PowerPoint, *.ppt, *.pps, *.pptx" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3153626\n" "11\n" "help.text" msgid "$[officename] Impress" msgstr "$[officename] Impress" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "hd_id3147303\n" "12\n" "help.text" msgid "Saving as a Microsoft Office File" msgstr "Lagra som ei Microsoft Office-fil" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3145068\n" "13\n" "help.text" msgid "Choose File - Save As." msgstr "Vel Fil → Lagra som." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3153379\n" "14\n" "help.text" msgid "In the File type box, select a Microsoft Office file format." msgstr "Vel eit Microsoft Office-filformat i feltet Filtype." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "hd_id3154138\n" "15\n" "help.text" msgid "Saving Documents by Default in Microsoft Office Formats" msgstr "Lagra dokument i Microsoft Office-format som standard" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3144760\n" "16\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - Load/Save - General." msgstr "Vel %PRODUCTNAME - InnstillingarVerktøy → InnstillingarLast inn/lagre → Generelt." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3148453\n" "17\n" "help.text" msgid "In the Default file format and ODF settings area, first select a document type, then select the file type for saving." msgstr "I Standard filformat og ODF-innstillingar vel du først ein dokumenttype og deretter filtypen som skal brukast ved lagring." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3149807\n" "18\n" "help.text" msgid "From now on, if you save a document, the File type will be set according to your choice. Of course, you still can select another file type in the file save dialog." msgstr "Frå nå av vert Filtype automatisk sett til det du valde kvar gong eit dokument vert lagra. Du kan sjølvsagt om ønskjeleg velja ein annan filtype i dialogvindauget." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "hd_id3156423\n" "19\n" "help.text" msgid "Opening Microsoft Office Files by Default" msgstr "Opna Microsoft Office-filer som standard" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "hd_id3153092\n" "20\n" "help.text" msgid "Converting Many Microsoft Office Files into OpenDocument Format" msgstr "Konvertera fleire Microsoft Office-filer til OpenDocument-format" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3146986\n" "21\n" "help.text" msgid "The Document Converter Wizard will copy and convert all Microsoft Office files in a folder into $[officename] documents in the OpenDocument file format. You can specify the folder to be read, and the folder where the converted files are to be saved." msgstr "Dokumentkonvertering vil kopiera og konvertera alle Microsoft Office-filer i ei mappe til $[officename]-dokument i OpenDocument-filformat. Du kan velja mappa som inneheld filene som skal lesast og kva mappe dei konverterte filene skal lagrast i." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3150486\n" "22\n" "help.text" msgid "Choose File - Wizards - Document Converter to start the wizard." msgstr "Vel Fil → Vegvisarar → Dokumentkonvertering for å starta vegvisaren." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "hd_id3154319\n" "23\n" "help.text" msgid "Macros in Microsoft Office and $[officename]" msgstr "Makroar i Microsoft Office og $[officename]" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3154921\n" "24\n" "help.text" msgid "With a few exceptions, Microsoft Office and $[officename] cannot run the same macro code. Microsoft Office uses VBA (Visual Basic for Applications) code, and $[officename] uses Basic code based on the $[officename] API (Application Program Interface) environment. Although the programming language is the same, the objects and methods are different." msgstr "Microsoft Office og $[officename] kan ikkje køyra den same makrokoden. Microsoft Office bruker VBA-kode (Visual Basic for Applications) og $[officename] bruker Basic-kode basert på API-miljøet (Application Program Interface) i $[officename]. Sjølv om programmeringsspråket er det same, er objekta og metodane ulike." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id0804200804173539\n" "help.text" msgid "The most recent versions of %PRODUCTNAME can run some Excel Visual Basic scripts if you enable this feature at %PRODUCTNAME - PreferencesTools - Options - Load/Save - VBA Properties." msgstr "Den nyaste versjonen av %PRODUCTNAME kan køyra visse Excel Visual Basic-skript viss du slår på denne funksjonen i %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → Last inn/lagra → VBA-eigenskapar." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3152577\n" "25\n" "help.text" msgid "If you use macros in one of the applications and want to use the same functionality in the other application, you must edit the macros. $[officename] can load the macros that are contained within Microsoft Office files and you can then view and edit the macro code in the $[officename] Basic IDE editor." msgstr "Viss du brukar makroar i eit av programma og vil bruka dei same funksjonane i det andre programmet, må du redigera makroane. $[officename] kan laste inn makroane som finst i Microsoft Office-filer. Dermed kan du visa og redigera makrokoden i $[officename] Basic-IDE." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "hd_id3152596\n" "26\n" "help.text" msgid "You can choose to preserve or delete VBA macros" msgstr "Du kan velja å behalda eller sletta VBA-makroar" #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3153144\n" "27\n" "help.text" msgid "Open a Microsoft Office document that contains VBA macro code. Change only the normal contents (text, cells, graphics), and do not edit the macros. Save the document as a Microsoft Office file type. Open the file in Microsoft Office, and the VBA macros will run as before." msgstr "Opna eit Microsoft Office-dokument som inneheld VBA-makrokode. Gjer berre endringar i det normale innhaldet (tekst, celler, bilete), ikkje rediger makroane. Lagra dokumentet som ein Microsoft Office-filtype. Opna fila i Microsoft Office og VBA-makroane vil køyra som før." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3150011\n" "28\n" "help.text" msgid "You may delete the VBA macros from the Microsoft Office file on loading or on saving." msgstr "Du kan sletta VBA-makroane frå Microsoft Office-fila når ho vert lasta inn eller lagra." #: ms_user.xhp msgctxt "" "ms_user.xhp\n" "par_id3155366\n" "29\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - Load/Save - VBA Properties to set the VBA macro handling of $[officename]." msgstr "Vel %PRODUCTNAME → InnstillingarVerktøy → InnstillingarLast inn/lagra → VBA-eigenskapar for å setja opp handteringa av VBA-makroen i $[officename]." #: navigator.xhp msgctxt "" "navigator.xhp\n" "tit\n" "help.text" msgid "Navigator for Document Overview" msgstr "Dokumentstruktur" #: navigator.xhp msgctxt "" "navigator.xhp\n" "bm_id3147008\n" "help.text" msgid "documents; contents as listsNavigator; contents as lists" msgstr "dokument; innhald som listerdokumentstruktur; innhald som lister" #: navigator.xhp msgctxt "" "navigator.xhp\n" "hd_id3147008\n" "4\n" "help.text" msgid "Navigator for Document Overview" msgstr "Dokumentstruktur" #: navigator.xhp msgctxt "" "navigator.xhp\n" "par_id3154823\n" "3\n" "help.text" msgid "All contents of the Navigator window are referred to here as \"categories,\" whether titles, sheets, tables, text frames, graphics, OLE objects, sections, hyperlinks, references, indexes or comments." msgstr "Alt innhaldet i vindauget for dokumentstruktur vert her referet til som «kategoriar», om det er titlar, ark, tabellar, tekst, rammer, bilete, OLE-objekt, bolkar, hyperlenkjer, referansar, indeksar eller merknadar." #: navigator.xhp msgctxt "" "navigator.xhp\n" "par_id3153662\n" "5\n" "help.text" msgid "The Navigator displays all types of objects contained in a document. If a plus sign appears next to a category, this indicates that at least one object of this kind exists. If you rest the mouse pointer on the category name, the number of objects is displayed in an extended tip." msgstr "Dokumentstrukturen viser alle typar objekt som eit dokument inneheld. Viss eit plussteikn vert vist ved sida av ein kategori, betyr dette at det finst minst eitt objekt av denne typen. Viss du held musepeikaren over namnet på ein kategori ei lita stund, vert talet på objekt av denne typen vist i eit utvida tips." #: navigator.xhp msgctxt "" "navigator.xhp\n" "par_id3146797\n" "6\n" "help.text" msgid "Open a category by clicking on the plus sign. If you only want to view the entries in a certain category, select the category and click the Content View icon. Until you click the icon again, only the objects of this category will be displayed." msgstr "Opna ein kategori ved å trykkja på plussteiknet. Viss du berre vil visa oppføringane i ein bestemt kategori, merkjer du kategorien og trykkjer på Innhaldsvising. Nå vert berre objekta i denne kategorien viste heilt til du trykkjer på knappen igjen." #: navigator.xhp msgctxt "" "navigator.xhp\n" "par_id3166461\n" "7\n" "help.text" msgid "You may dock the Navigator to any document border or turn it back into a free window (double click on the gray area). You can change the size of the Navigator when it is a free window." msgstr "Du kan festa dokumentstrukturvindauget til kva kant i dokumentet som hels, eller gjera det om til eit flytande vindauge (dobbeltklikk i eit grått område). Når Dokumentstruktur er eit flytande vindauge, kan du endra storleiken på det." #: navigator_setcursor.xhp msgctxt "" "navigator_setcursor.xhp\n" "tit\n" "help.text" msgid "Navigation to Quickly Reach Objects" msgstr "Bruka dokumentstruktur for å koma raskt til objekt" #: navigator_setcursor.xhp msgctxt "" "navigator_setcursor.xhp\n" "bm_id3150774\n" "help.text" msgid "Document Map, see Navigatorcursor;quickly moving to an objectobjects;quickly moving tonavigating;in documentsNavigator;working with" msgstr "dokumentoversikt, sjå dokumentstrukturskrivemerke; flytta raskt til eit objektobjekt; flytta raskt tilnavigere; i dokumentdokumentstruktur;arbeida med" #: navigator_setcursor.xhp msgctxt "" "navigator_setcursor.xhp\n" "hd_id3150774\n" "8\n" "help.text" msgid "Navigation to Quickly Reach Objects" msgstr "Bruka dokumentstruktur for å koma raskt til objekt " #: navigator_setcursor.xhp msgctxt "" "navigator_setcursor.xhp\n" "par_id3145071\n" "9\n" "help.text" msgid "This is a common use of the Navigator." msgstr "Dette er ein vanleg måte å bruka dokumentstruktur på." #: navigator_setcursor.xhp msgctxt "" "navigator_setcursor.xhp\n" "par_id3145382\n" "10\n" "help.text" msgid "Double-click an object in the Navigator to jump directly to the position of the object in the document." msgstr "Dobbeltklikk på eit objekt i dokumentstruktur for å gå direkte til der objektet er plassert i dokumentet." #: navigator_setcursor.xhp msgctxt "" "navigator_setcursor.xhp\n" "par_id3163802\n" "11\n" "help.text" msgid "You can use the Navigation toolbar to scroll to the previous or next object of a specific category." msgstr "Du kan bruka den flytande verktøylinja Navigering til gå til det førre eller neste objektet i ein bestemt kategori." #: navigator_setcursor.xhp msgctxt "" "navigator_setcursor.xhp\n" "par_id3148491\n" "12\n" "help.text" msgid "Open the toolbar using the Navigation icon below the vertical scroll bar of a text document, or in the Navigator window." msgstr "Opna verktøylinja ved å trykkja på Navigering under det loddrette rullefeltet i eit tekstdokument, eller trykk på knappen med det same namnet i vindauget Dokumentstruktur." #: navigator_setcursor.xhp msgctxt "" "navigator_setcursor.xhp\n" "par_id3153348\n" "13\n" "help.text" msgid "On the Navigation toolbar, you first select the category, then click on one of the buttons, Previous Object or Next Object. The names of the buttons refer to the category, for example, the button \"Next Object\" is named \"Next Page\" or \"Next Bookmark\" according to the category." msgstr "På den flytande verktøylinja Navigering merkjer du først kategorien. Deretter trykkjer du på ein av knappane, som har namn etter mønsteret Førre objekt eller Neste objekt. Kva namn som vert vist på knappane er avhengig av kategorien som er vald. For eksempel kan knappen «Neste objekt» ha namnet «Neste side» eller «Neste bokmerke»." #: navpane_on.xhp msgctxt "" "navpane_on.xhp\n" "tit\n" "help.text" msgid "Showing Navigation Pane of the Help" msgstr "Visa navigasjonspanelet i Hjelp" #: navpane_on.xhp msgctxt "" "navpane_on.xhp\n" "bm_id3155364\n" "help.text" msgid "Help; navigation pane showing/hidinghiding;navigation pane in Help windowindexes;showing/hiding Help index tab" msgstr "Hjelp; vise/gøyma navigasjonspaneletgøyma;navigasjonspanelet i hjelpevindaugetindekser;vise/gøyma Hjelp-indeksfanen" #: navpane_on.xhp msgctxt "" "navpane_on.xhp\n" "hd_id3150178\n" "1\n" "help.text" msgid "Showing Navigation Pane of the Help" msgstr "Visa navigasjonspanelet i hjelp" #: navpane_on.xhp msgctxt "" "navpane_on.xhp\n" "par_id3147571\n" "2\n" "help.text" msgid "In the Help window, you can show or hide the navigation pane as needed." msgstr "I hjelpevindauget kan du visa eller gøyma navigasjonspanelet etter behov." #: navpane_on.xhp msgctxt "" "navpane_on.xhp\n" "par_id3156411\n" "help.text" msgid "Icon" msgstr "Ikon" #: navpane_on.xhp msgctxt "" "navpane_on.xhp\n" "par_id3152996\n" "3\n" "help.text" msgid "On the toolbar of the Help window, click the left icon to show or hide the navigation pane." msgstr "Trykk på knappen lengst til venstre på verktøylinja i vindauget Hjelp for å visa eller gøyma navigasjonspanelet." #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "tit\n" "help.text" msgid "Turning off Bullets and Numbering for Individual Paragraphs" msgstr "Slå av punktmerking og nummerering i enkelte avsnitt" #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "bm_id3154186\n" "help.text" msgid "numbering; turning off bullets; turning off removing, see also deleting removing;bullets and numbering keyboard;removing numbering" msgstr "nummerering; slå avpunkt; slå avfjerna, sjå også slettafjerna;punkt og nummereringtastatur;fjerna nummerering" #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "hd_id3154186\n" "10\n" "help.text" msgid "Turning off Bullets and Numbering for Individual Paragraphs" msgstr "Slå av punktmerking og nummerering i enkelte avsnitt" #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "par_id0202200910470118\n" "help.text" msgid "Bullets and Numbering of paragraphs is supported only in Writer, Impress and Draw." msgstr "Punktmerking og nummerering av avsnitt er berre støtta i Writer, Impress og Draw." #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "par_id3154288\n" "help.text" msgid "Icon" msgstr "Ikon" #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "par_id3150443\n" "help.text" msgid "Icon" msgstr "Ikon" #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "par_id3147618\n" "11\n" "help.text" msgid "For the current paragraph or selected paragraphs you can switch off the automatic numbering or listing. Click the Numbering Off icon in the Bullets and Numbering bar." msgstr "Du kan slå av automatisk nummerering eller punktmerking i det gjeldande avsnittet eller det merkte avsnittet. Trykk på Nummerering av i verktøylinja Punktmerking og nummerering." #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "par_id3155449\n" "help.text" msgid "Icon" msgstr "Ikon" #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "par_id3144511\n" "31\n" "help.text" msgid "If the cursor is located within a numbered or bulleted list, you can turn off automatic numbers or bullets for the current paragraph or selected paragraphs by clicking the Bullets On/Off icon on the Text Formatting bar." msgstr "Viss skrivemerket står i ei liste med nummerering eller punktmerking, kan du slå av automatisk nummerering eller punktmerking i det gjeldande avsnittet eller merkte avsnittet ved å trykkja på Punktmerking på/av i verktøylinja Formatering." #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "par_id3148946\n" "12\n" "help.text" msgid "To remove numbering from a paragraph using the keyboard: " msgstr "Slik fjernar du nummerering frå eit avsnitt ved hjelp av tastaturet:" #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "par_id3148663\n" "13\n" "help.text" msgid "Place the cursor at the beginning of a numbered paragraph and press the Backspace key. " msgstr "Plasser skrivemerket i byrjinga av eit nummerert avsnitt og trykk rettetasten." #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "par_id3150543\n" "14\n" "help.text" msgid "The numbering of the paragraph disappears and is removed from the numbering sequence. Numbering resumes in the following paragraph. " msgstr "Nummereringa av avsnittet forsvinn og vert fjerna frå nummerrekkjefølgja. Nummereringa held fram i det neste avsnittet." #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "par_id3154123\n" "15\n" "help.text" msgid "If you press the Enter key in an empty numbered paragraph, the numbering stops. " msgstr "Viss du trykkjer på «Enter» i eit tomt, nummerert avsnitt, stoppar nummereringa." #: numbering_stop.xhp msgctxt "" "numbering_stop.xhp\n" "par_id3151043\n" "32\n" "help.text" msgid "Format - Bullets and Numbering" msgstr "Format → Punkt og nummerering" #: pageformat_max.xhp msgctxt "" "pageformat_max.xhp\n" "tit\n" "help.text" msgid "Selecting the Maximum Printable Area on a Page" msgstr "Merka det største utskriftsområdet på ei side" #: pageformat_max.xhp msgctxt "" "pageformat_max.xhp\n" "bm_id3149180\n" "help.text" msgid "page formats; maximizingformats; maximizing page formatsprinters; maximum page formats" msgstr "sideformat; gjera størreformat; gjera sideformat størreskrivarar; største sideformat" #: pageformat_max.xhp msgctxt "" "pageformat_max.xhp\n" "hd_id3149180\n" "35\n" "help.text" msgid "Selecting the Maximum Printable Area on a Page" msgstr "Merka det største utskriftsområdet på ei side " #: pageformat_max.xhp msgctxt "" "pageformat_max.xhp\n" "par_id3156426\n" "36\n" "help.text" msgid "Not all printers can print a paper up to its edges. Most of them leave an unprinted margin." msgstr "Ikkje alle skrivarane kan skriva heilt ut til kantane på papiret. Dei fleste let det stå igjen ein tom marg." #: pageformat_max.xhp msgctxt "" "pageformat_max.xhp\n" "par_id3149182\n" "37\n" "help.text" msgid "$[officename] offers a semi-automatic feature that enables you to print as close to the paper's edge as is possible." msgstr "$[officename] har ein halvautomatisk funksjon som let deg skriva ut så langt ut mot papirkantane som mogleg." #: pageformat_max.xhp msgctxt "" "pageformat_max.xhp\n" "par_id3159233\n" "38\n" "help.text" msgid "Make sure that your printer has been setup under File - Printer Settings." msgstr "Sjå etter at skrivaren er sett opp under Fil → Skrivarinnstillingar." #: pageformat_max.xhp msgctxt "" "pageformat_max.xhp\n" "par_id3156114\n" "39\n" "help.text" msgid "Make sure that the Web Layout in the View menu is not selected." msgstr "Sjå etter at du ikkje har markert Vevoppsett i Vis-menyen." #: pageformat_max.xhp msgctxt "" "pageformat_max.xhp\n" "par_id3147653\n" "40\n" "help.text" msgid "Select the Format - Page command, and go to the Page tab." msgstr "Vel Format → Side og gå til fana Side." #: pageformat_max.xhp msgctxt "" "pageformat_max.xhp\n" "par_id3147335\n" "41\n" "help.text" msgid "Under Margins you can define the maximum or minimum possible value for the page margins (left, right, top, and bottom). Click into the respective control, then press the Page Up or Page Down key. The preview displays a dashed line around the printable range." msgstr "Under Margar kan du velja den største eller den minste moglege verdien for sidemargane (venstre, høgre, øvst og nedst). Plasser markøren i den aktuelle talboksen og trykk «Page Up» eller «Page Down». Førehandsvisinga viser ei linje rundt området som kan skrivast ut." #: pageformat_max.xhp msgctxt "" "pageformat_max.xhp\n" "par_id3145120\n" "42\n" "help.text" msgid "Click OK to close the dialog." msgstr "Trykk på OK for å lukka dialogvindauget." #: pageformat_max.xhp msgctxt "" "pageformat_max.xhp\n" "par_id3155388\n" "43\n" "help.text" msgid "Printing" msgstr "Skriva ut" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "tit\n" "help.text" msgid "Copying Attributes With the Clone Formatting Tool" msgstr "Kopiera attributt med formatpenselen" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "bm_id380260\n" "help.text" msgid "Format Paintbrush clone formatting formatting;copying copying;formatting Paintbrush" msgstr "formatpensel klone formatering formatering;kopierakopiera;formatering pensel" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN1053A\n" "help.text" msgid "Copying Formatting With the Clone Formatting Tool" msgstr "Kopiera formatering med formatpenselen" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN10655\n" "help.text" msgid "You can use the Clone Formatting tool to copy formatting from a text selection or from an object and apply the formatting to another text selection or object." msgstr "Du kan bruka formatpenselen til å kopiera formatering frå merkt tekst eller frå eit objekt og bruka formateringa på ein annan merkt tekst eller eit objekt." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_id101920091122570\n" "help.text" msgid "In Calc, the Clone Formatting tool only applies to cell formatting." msgstr "I Calc kan formatpenselen brukast berre til formatering av celler." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106DD\n" "help.text" msgid "Select the text or object whose formatting you want to copy." msgstr "Merk teksten eller objektet som har den formateringa du vil kopiera." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN10667\n" "help.text" msgid "On the Standard Bar, click the Clone Formatting icon." msgstr "2. Trykk på Formatpensel i standardverktøylinja." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN10660\n" "help.text" msgid "The cursor changes to a paint bucket." msgstr "Peikaren vert endra til eit målingspann." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN10663\n" "help.text" msgid "If you want to apply the formatting to more than one selection, double-click the Clone Formatting iconIcon. After you apply all the formatting, click the icon again." msgstr "Viss du vil bruka formateringa på meir enn eitt utval, dobbeltklikk på formateringspenselen Ikon. Klikk på knappen igjen når du er ferdig med formateringa." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN1066E\n" "help.text" msgid "Select or click the text or object that you want to apply the formatting to." msgstr "Merk eller trykk på teksten eller objektet du vil bruka formateringa på." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN10716\n" "help.text" msgid "By default only the character formatting is copied ; to include paragraph formatting, hold down CommandCtrl when you click. To copy only the paragraph formatting, hold down CommandCtrl+Shift when you click." msgstr "Viss du ikkje vil bruka avsnittsformatering, hald nede CmdCtrl når du trykkjer. Viss du ikkje vil bruke teiknformatering, hald nede CmdCtrl + Shift når du trykkjer." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN10672\n" "help.text" msgid "The paragraph formats are the formats applied to the whole paragraph. The character formats are those applied to a portion of the paragraph. For example, if you apply the bold format to a whole paragraph the bold format is a paragraph format. Then if you unbold a portion of this paragraph, the bold format is still a paragraph format but the portion you unbold has a \"not bold\" character format." msgstr "Avsnitts-format er dei formata som vert brukte på heile avsnitt. Teikn-format er dei formata som vert brukte på ein del av eit avsnitt. Viss du for eksempel brukar feit skrift på eit heilt avsnitt, er formatet eit avsnitts-format. Viss du seinare fjerner formatet feit skrift frå deler av avsnittet, vil feit skrift framleis vera eit avsnitts-format, medan den delen som feit skrift er fjerna frå vil vera eit teikn-format." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN10671\n" "help.text" msgid "The following table describes the formatting attributes that the Clone Formatting tool can copy:" msgstr "Tabellen nedanfor viser formateringseigenskapane som formatpenselen kan kopiera:" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN10691\n" "help.text" msgid "Type of Selection" msgstr "Utvalstype" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN10697\n" "help.text" msgid "Comment" msgstr "Merknad" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN1069E\n" "help.text" msgid "Nothing selected, but cursor is inside a text passage" msgstr "Ingenting er merkt, men skrivemerket står inne i ein tekst" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106A4\n" "help.text" msgid "Copies the formatting of the current paragraph and the character formatting of the next character in the text flow direction." msgstr "Kopierer formateringa i det gjeldande avsnittet og teiknformateringa for det neste teiknet i tekstretninga." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106AB\n" "help.text" msgid "Text is selected" msgstr "Tekst er merkt." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106B1\n" "help.text" msgid "Copies the formatting of the last selected character and of the paragraph that contains the character." msgstr "Kopierer formateringa av det siste teiknet i utvalet og avsnittet som inneheld teiknet." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106B8\n" "help.text" msgid "Frame is selected" msgstr "Ei ramme er merkt" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106BE\n" "help.text" msgid "Copies the frame attributes that are defined in Format - Frame dialog. The contents, size, position, linking, hyperlinks, and macros in the frame are not copied." msgstr "Kopierer rammeeigenskapane som er definerte i dialogvindauget Format → Ramme. Innhaldet, storleiken, plasseringa, lenkjer, hyperlenkjer og makroar i ramma vert ikkje kopierte." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106C5\n" "help.text" msgid "Object is selected" msgstr "Objektet er merkt" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106CB\n" "help.text" msgid "Copies the object formatting that is defined in the Format - Graphics or Format - Drawing Object dialogs. The contents, size, position, hyperlinks, and macros in the object are not copied." msgstr "Kopierer objektformateringa som er definerte i dialogvindauget Format → Bilete eller Format → Biletobjekt. Innhaldet, storleiken, plasseringa, lenkjer, hyperlenkjer og makroar i objektet vert ikkje kopierte. " #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106D2\n" "help.text" msgid "Form control is selected" msgstr "Eit skjemakontrollelement er merkt." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106D8\n" "help.text" msgid "Not supported" msgstr "Ikkje støtta" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106DF\n" "help.text" msgid "Drawing object is selected" msgstr "Eit teikneobjekt er merkt" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106E5\n" "help.text" msgid "Copies all formatting attributes. In Impress and Draw, the text contents of the object is also copied." msgstr "Kopierer alle formateringseigenskapane. I Impress og Draw vert også eventuelt tekstinnhald i objektet kopiert." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106EC\n" "help.text" msgid "Text within Calc cells is selected" msgstr "Tekst inne i celler i Calc er merkt" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106F2\n" "help.text" msgid "Not supported" msgstr "Ikkje støtta" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106F9\n" "help.text" msgid "Writer table or cells are selected" msgstr "Ein tabell eller celler i Writer er merkt." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN106FF\n" "help.text" msgid "Copies the formatting that is specified in Table, Text Flow, Borders, and Background tab pages in the Format - Table dialog. The paragraph and character formatting are also copied." msgstr "Kopierer formateringa som er sett i fanene «Tabell», «Tekstflyt», «Kantar» og «Bakgrunn» i dialogvindauget Format → Tabell. Også avsnitt- og teiknformatering vert kopiert." #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN10706\n" "help.text" msgid "Calc table or cells are selected" msgstr "Ein tabell eller celler i Calc er merkt" #: paintbrush.xhp msgctxt "" "paintbrush.xhp\n" "par_idN1070C\n" "help.text" msgid "Copies the formatting that is specified in the Format - Cells dialog as well as the formatting of the cell contents" msgstr "Kopierer formateringa som er sett i dialogvindauget Format → Celler. Også formateringa av celleinnhaldet vert kopiert. " #: pasting.xhp msgctxt "" "pasting.xhp\n" "tit\n" "help.text" msgid "Pasting Contents in Special Formats" msgstr "Lima inn innhald i spesielle format" #: pasting.xhp msgctxt "" "pasting.xhp\n" "bm_id3620715\n" "help.text" msgid "clipboard;pasting formatted/unformatted textinserting;clipboard optionspasting;formatted/unformatted texttext formats;pastingformats;pasting in special formats" msgstr "utklippstavle;lime inn formatert/uformatert tekstsetja inn;val for utklippstavlalima inn;formatert/uformatert teksttekstformat;lima innformat;lima inn spesielle format" #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN10725\n" "help.text" msgid "Pasting Contents in Special Formats" msgstr "Lima inn innhald i spesielle format" #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN10743\n" "help.text" msgid "Contents that are stored on the clipboard can be pasted into your document using different formats. In %PRODUCTNAME you can choose how to paste the contents using a dialog or a drop-down icon." msgstr "Innhald som er lagra i utklippstavla kan limast inn i dokumentet ved å bruka ulike format. I %PRODUCTNAME kan du velja korleis innhaldet skal setjast inn ved hjelp av eit dialogvindauge eller ein nedtrekksknapp." #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN10746\n" "help.text" msgid "The available options depend on the contents of the clipboard." msgstr "Vala som er tilgjengelege er avhengige av innhaldet i utklippstavla." #: pasting.xhp msgctxt "" "pasting.xhp\n" "hd_id3144547360\n" "help.text" msgid "In Writer text documents, you can press Command+OptionCtrl+Alt+Shift+V to paste the contents of the clipboard as unformatted text." msgstr "I tekstdokument i Writer kan du lima inn uformatert tekst frå utklippstavla ved å trykkja Cmd + TilvalCtrl + Alt + Shift + V." #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN10749\n" "help.text" msgid "Pasting clipboard contents using an icon menu" msgstr "Lima inn innhaldet frå utklippstavla ved hjelp av ein knappemeny" #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN10750\n" "help.text" msgid "Click the arrow next to the Paste icon on the Standard Bar to open the menu." msgstr "Trykk på pila til høgre for knappen Lim inn på standardverktøylinja for å opna menyen." #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN10758\n" "help.text" msgid "Select one of the options." msgstr "Vel eitt av alternativa." #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN1075B\n" "help.text" msgid "If you do not like the result, click the Undo icon and then paste again with another option." msgstr "Viss du ikkje likar resultatet, kan du trykkja på knappen Angra og eventuelt lime inn eit av dei andre alternativ." #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN10762\n" "help.text" msgid "Pasting clipboard contents using a dialog" msgstr "Lima inn innhaldet på utklippstavla ved hjelp av eit dialogvindauge" #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN10769\n" "help.text" msgid "Choose Edit - Paste special." msgstr "Vel Rediger → Lim inn utval." #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN10771\n" "help.text" msgid "Select one of the options and click OK." msgstr "Vel eit av alternativa og trykk på OK." #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN10774\n" "help.text" msgid "If you are in a spreadsheet and the contents of the clipboard are spreadsheet cells, then a different Paste Special dialog appears. Use the Paste Special dialog to copy cells using basic or advanced options." msgstr "Viss du er i eit rekneark og innhaldet på utklippstavla er reknearkceller, vil dialogvindauget Lim inn utval sjå litt annleis ut. Bruk dialogvindauget Lim inn utval til å kopiera celler ved hjelp av grunnleggjande eller avanserte alternativ." #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN1077E\n" "help.text" msgid "Transpose: swaps the rows and the columns of the cell range to be pasted." msgstr "Byt rader og kolonnar: gjer radene om til kolonnar og kolonnane om til rader i celleområdet som skal limast inn." #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN10785\n" "help.text" msgid "Link: pastes the cell range as a link. If the source file changes, the pasted cells change also." msgstr "Lenkje: limer celleområdet inn som ei lenkje. Viss kjeldefila vert endra, vil også innhaldet i cellene du har limt inn endra seg." #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN1078C\n" "help.text" msgid "The other options are explained in the help, when you call the Paste Special dialog from within %PRODUCTNAME Calc." msgstr "Dei andre alternativa er forklarte i hjelpa som kjem fram når du brukar %PRODUCTNAME Calc og trykkjer på Hjelp i dialogvindauget Lim inn utval." #: pasting.xhp msgctxt "" "pasting.xhp\n" "par_idN107BA\n" "help.text" msgid "Paste Special" msgstr "Lim inn utval" #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "tit\n" "help.text" msgid "Printing in Black and White" msgstr "Skriva ut i svart-kvitt" #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "bm_id3150125\n" "help.text" msgid "printing; black and white black and white printing colors; not printing text; printing in black" msgstr "utskrift; svart-kvittsvart-kvit utskriftfargar; ikkje skriv uttekst; utskrift i svart-kvitt" #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "hd_id3150125\n" "1\n" "help.text" msgid "Printing in Black and White" msgstr "Skriva ut i svart-kvitt" #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "hd_id3150499\n" "3\n" "help.text" msgid "Printing text and graphics in black and white" msgstr "Skriva ut tekst og bilete i svart-kvitt" #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3149346\n" "4\n" "help.text" msgid "Choose File - Print. The General tab page of the dialog opens." msgstr "Vel Fil → Skriv ut. Dette vil opna dialogvindauget Generelt." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3155892\n" "5\n" "help.text" msgid "Click on Properties. This opens the Properties dialog for your printer." msgstr "Trykk på Eigenskapar for å opna eit dialogvindauge med eigenskapane til skrivaren du brukar." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3145313\n" "6\n" "help.text" msgid "Select the option to print in black and white. For further information, refer to the user's manual of your printer." msgstr "Merk av for utskrift i svart-kvitt. Du finn fleire opplysingar i handboka til skrivaren du brukar." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3153345\n" "7\n" "help.text" msgid "Confirm the Properties dialog and click Print." msgstr "Bekreft dialogvindauget Eigenskapar og trykk på Skriv ut." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3156113\n" "8\n" "help.text" msgid "The current document will be printed in black and white." msgstr "Det gjeldande dokumentet vert nå skrive ut i svart-kvitt." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "hd_id3147653\n" "9\n" "help.text" msgid "Printing in black and white in %PRODUCTNAME Impress and %PRODUCTNAME Draw" msgstr "Skriva ut i svart-kvitt i %PRODUCTNAME Impress og %PRODUCTNAME Draw" #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3149233\n" "10\n" "help.text" msgid "Choose Tools - Options - %PRODUCTNAME Impress or Tools - Options - %PRODUCTNAME Draw, as appropriate." msgstr "Vel Verktøy → Innstillingar → %PRODUCTNAME Impress eller Verktøy → Innstillingar → %PRODUCTNAME Draw, avhengig av kva som passar." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3150275\n" "11\n" "help.text" msgid "Then choose Print." msgstr "Vel deretter Skriv ut." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3147573\n" "12\n" "help.text" msgid "Under Quality, select either Grayscale or Black & white and click OK." msgstr "Under Utskriftskvalitet vel du anten Gråtoner eller Svart-kvitt og trykkjer på OK." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3154307\n" "13\n" "help.text" msgid "When either of these options is selected, all presentations or drawings will be printed without color. If you only want to print in black for the current print job, select the option in File - Print - %PRODUCTNAME Draw/Impress." msgstr "Når ei av desse innstillingane er vald, vert alle presentasjonar og teikningar skrive ut utan farge. Viss du ønskjer å skriva ut berre det gjeldande dokumentet i svart, vel innstillinga i Fil → Skriv ut → %PRODUCTNAME Draw/Impress." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3149786\n" "15\n" "help.text" msgid "Grayscale converts all colors to a maximum of 256 gradations from black to white. All text will be printed in black. A background set by Format - Page - Background will not be printed." msgstr "Gråskala omformar alle fargane til opp til 256 toner frå svart til kvitt. All tekst vert skrive i svart. Ein bakgrunn sett med Format → Side → Bakgrunn vert ikkje skrive ut." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3145610\n" "16\n" "help.text" msgid "Black & white converts all colors into the two values black and white. All borders around objects are printed black. All text will be printed in black. A background set by Format - Page - Background will not be printed." msgstr "Svart/kvitt omformar alle fargane til dei to verdiane svart og kvit. Alle kantane rundt objektet og all tekst vert skrive ut i svart. Ein bakgrunn sett med Format → Side → Bakgrunn vert ikkje skrive ut." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "hd_id3153896\n" "17\n" "help.text" msgid "Printing only text in black and white" msgstr "Skriva ut berre tekst i svart-kvitt" #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3147559\n" "18\n" "help.text" msgid "In %PRODUCTNAME Writer you can choose to print color-formatted text in black and white. You can specify this either for all subsequent text documents to be printed, or only for the current printing process." msgstr "I %PRODUCTNAME Writer kan du velja å skriva ut tekst formatert med fargar i svart-kvitt. Du kan velja å gjera dette anten for alle tekstdokument som vert skrive ut etterpå, eller berre for den gjeldande utskrifta." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "hd_id3150358\n" "19\n" "help.text" msgid "Printing all text documents with black and white text" msgstr "Skriva ut alle tekstdokument med tekst i svart-kvitt" #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3150541\n" "20\n" "help.text" msgid "Choose Tools - Options - %PRODUCTNAME Writer or Tools - Options - %PRODUCTNAME Writer/Web." msgstr "Vel Verktøy → Innstillingar → %PRODUCTNAME Writer eller Verktøy → Innstillingar → %PRODUCTNAME Writer/Web." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3147084\n" "21\n" "help.text" msgid "Then choose Print." msgstr "Vel deretter Skriv ut." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3154910\n" "22\n" "help.text" msgid "Under Contents, mark Print black and click OK." msgstr "Under Innhald vel du Skriv ut i svart-kvitt og trykkjer på OK." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3144762\n" "23\n" "help.text" msgid "All text documents or HTML documents will be printed with black text." msgstr "Alle tekstdokument og HTML-dokument vert nå skrive ut med svart tekst." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "hd_id3148920\n" "24\n" "help.text" msgid "Printing the current text document with black and white text" msgstr "Skriva ut det gjeldande tekstdokumentet med tekst i svart-kvitt" #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3152933\n" "25\n" "help.text" msgid "Choose File - Print. Then click the %PRODUCTNAME Writer tab." msgstr "Vel Fil → Skriv ut og trykk deretter på fana %PRODUCTNAME Writer." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3149667\n" "27\n" "help.text" msgid "Choose Print text in black and click Print." msgstr "Merk av for Utskrift i svart og trykk Skriv ut." #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3153726\n" "29\n" "help.text" msgid "Printing dialogs" msgstr "Utskriftsdialogvindauge" #: print_blackwhite.xhp msgctxt "" "print_blackwhite.xhp\n" "par_id3154146\n" "30\n" "help.text" msgid "Tools - Options dialog" msgstr "Dialogvindauget Verktøy → Innstillingar" #: print_faster.xhp msgctxt "" "print_faster.xhp\n" "tit\n" "help.text" msgid "Printing with Reduced Data" msgstr "Skriva ut med reduserte data" #: print_faster.xhp msgctxt "" "print_faster.xhp\n" "bm_id5201574\n" "help.text" msgid "gradients off for faster printingbitmaps;off for faster printingresolution when printing bitmaps transparency;off for faster printingreduced printingspeed of printingprinting speedprinting;transparenciesprinting;fasterfaster printing" msgstr "fargeovergangar;slått av for raskare utskriftpunktbilete;slått av for raskare utskriftoppløysing i punktbilete ved utskrift gjennomsikt;slått av for raskare utskriftredusert utskriftutskriftsfartfart på utskriftutskrift;gjennomsiktutskrift;raskareraskare utskrift" #: print_faster.xhp msgctxt "" "print_faster.xhp\n" "par_idN106AA\n" "help.text" msgid "Printing faster with Reduced Data" msgstr "Skriva ut raskare med reduserte data" #: print_faster.xhp msgctxt "" "print_faster.xhp\n" "par_idN106C8\n" "help.text" msgid "You can decide to reduce the data necessary to print your document. The settings can be defined differently for printing directly to the printer or for printing to a file." msgstr "Du kan velja å redusera mengda med data som er nødvendig for å skriva ut dokumentet. Du kan velja forskjellige innstillingar for utskrift direkte til skrivaren og for utskrift til ei fil." #: print_faster.xhp msgctxt "" "print_faster.xhp\n" "par_idN106CE\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - $[officename] - Print." msgstr "Vel %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → $[officename] → Skriv ut." #: print_faster.xhp msgctxt "" "print_faster.xhp\n" "par_idN106D6\n" "help.text" msgid "Click one of the following settings options:" msgstr "Trykk på eitt av desse innstillingsvala:" #: print_faster.xhp msgctxt "" "print_faster.xhp\n" "par_idN106D9\n" "help.text" msgid "Printer - to define options for reducing data while printing directly to a printer" msgstr "Skrivar- for å angje innstillingar for reduserte data ved utskrift direkte til ein skrivar" #: print_faster.xhp msgctxt "" "print_faster.xhp\n" "par_idN106E2\n" "help.text" msgid "Print to file - to define options for reducing data while printing to a file" msgstr "Skriv til fil- for å angje innstillingar for reduserte data ved utskrift til ei fil" #: print_faster.xhp msgctxt "" "print_faster.xhp\n" "par_idN106EC\n" "help.text" msgid "Select any combination of the four options, then click OK." msgstr "Merk av for kombinasjonane du vil bruka blant dei fire vala og trykk på OK." #: print_faster.xhp msgctxt "" "print_faster.xhp\n" "par_idN106EF\n" "help.text" msgid "All documents that you print from now on will use the changed options." msgstr "Alle dokument du skriv ut frå nå av, vil bruka dei endra innstillingane." #: print_faster.xhp msgctxt "" "print_faster.xhp\n" "par_idN106F3\n" "help.text" msgid "Print your document." msgstr "Skriv ut dokumentet." #: print_faster.xhp msgctxt "" "print_faster.xhp\n" "par_idN106F6\n" "help.text" msgid "You can reduce data for transparency, for gradients, or for bitmaps. When you reduce the data, on many printers you will not see a reduction of printing quality. But the printing time is substantially shorter, and when you print to a file, the file size is much smaller." msgstr "Du kan redusera data for gjennomsikt, for fargeovergangar eller for bilete. Når du reduserer data, vil du for mange skrivarar ikkje sjå endring i utskriftskvaliteten, men tida det tar å skriva ut dokumentet vert merkbart kortare og når du skriv ut til ei fil vert storleiken mindre." #: print_faster.xhp msgctxt "" "print_faster.xhp\n" "par_idN10704\n" "help.text" msgid "Print options" msgstr "Utskriftsval" #: protection.xhp msgctxt "" "protection.xhp\n" "tit\n" "help.text" msgid "Protecting Content in %PRODUCTNAME" msgstr "Verna innhald i %PRODUCTNAME" #: protection.xhp msgctxt "" "protection.xhp\n" "bm_id3150620\n" "help.text" msgid "protecting; contents protected contents contents protection encryption of contents passwords for protecting contents security;protecting contents form controls; protecting draw objects;protecting OLE objects;protecting graphics;protecting frames;protecting" msgstr "verna; indhald verna indhald indhaldsvern kryptering av indhald passord for vern av indhald tryggleik;verna indhald skjemakontrollelement; verna teikneobjekt;verna OLE-objekt;verna grafikk;verna rammer;verna" #: protection.xhp msgctxt "" "protection.xhp\n" "hd_id3155364\n" "2\n" "help.text" msgid "Protecting Content in %PRODUCTNAME" msgstr "Verna innhald i %PRODUCTNAME" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3153394\n" "3\n" "help.text" msgid "The following is an overview of the different ways of protecting contents in %PRODUCTNAME from being modified, deleted or viewed." msgstr "Det følgjande er eit oversyn over dei ulike metodane du kan bruka for å verna innhaldet i %PRODUCTNAME mot endring, sletting eller vising." #: protection.xhp msgctxt "" "protection.xhp\n" "hd_id3146957\n" "4\n" "help.text" msgid "Protecting All Documents When Saving" msgstr "Verna alle dokument når dei vert lagra" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3150775\n" "5\n" "help.text" msgid "All documents that are saved in OpenDocument format can be saved with a password. Documents that are saved with a password cannot be opened without the password. The content is secured so that it cannot be read with an external editor. This applies to content, graphics and OLE objects." msgstr "Alle dokument som vert lagra i OpenDocument-format, kan lagrast med eit passord. Dokument som vert lagra med eit passord, kan ikkje opnast utan at passordet vert skrive inn. Innhaldet er sikra slik at det ikkje kan lesast med eit eksternt redigeringsprogram. Dette gjeld både innhald, bilete og OLE-objekt." #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3166410\n" "6\n" "help.text" msgid "Turning on protection" msgstr "Slå på vern" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3145121\n" "7\n" "help.text" msgid "Choose File - Save As and mark the Save with password check box. Save the document." msgstr "Vel Fil → Lagra som og merk av for Lagra med passord. Lagra dokumentet." #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3154286\n" "8\n" "help.text" msgid "Turning off protection" msgstr "Slå av vern" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3148492\n" "9\n" "help.text" msgid "Open the document, entering the correct password. Choose File - Save As and clear the Save with password check box." msgstr "Opna dokumentet og skriv inn det korrekte passordet. Vel Fil → Lagra som og fjern merket i avkrysningsboksen Lagra med passord." #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3145068\n" "64\n" "help.text" msgid "Information entered in File - Properties is not encrypted. This includes the name of the author, creation date, word and character counts." msgstr "Informasjon du skriv inn i Fil → Eigenskapar vert ikkje kryptert. Denne informasjonen omfattar forfattarnamn, dato då fila vart oppretta og talet på ord og teikn i fila." #: protection.xhp msgctxt "" "protection.xhp\n" "hd_id3149294\n" "10\n" "help.text" msgid "Protecting Revision Marking" msgstr "Verna revisjonsmerking" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3161646\n" "11\n" "help.text" msgid "With every change made in %PRODUCTNAME Calc and %PRODUCTNAME Writer, the review function records who made the change. This function can be turned on with protection, so that it can only be turned off when the correct password is entered. Until then, all changes will continue to be recorded. Acceptance or rejection of changes is not possible." msgstr "Kvar gong noko vert endra i %PRODUCTNAME Calc og %PRODUCTNAME Writer, vert det registrert kven som har gjort endringa. Denne funksjonen kan slåast på med vern, slik at den berre kan slåast av når det rette passordet vert skrive inn. Før dette skjer, vert alle endringar registrerte og det er ikkje mogleg å godta eller avvisa endringar." #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3154684\n" "12\n" "help.text" msgid "Turning on protection" msgstr "Slå på vern" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3153104\n" "13\n" "help.text" msgid "Choose Edit - Track Changes - Protect Changes. Enter and confirm a password of at least one character." msgstr "Vel Rediger → Endringar → Vern endringar. Skriv inn og bekreft eit passord på minste eitt teikn." #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3144760\n" "14\n" "help.text" msgid "Turning off protection" msgstr "Slå av vern" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3152920\n" "15\n" "help.text" msgid "Choose Edit - Track Changes - Protect Changes. Enter the correct password." msgstr "Vel Rediger → Endringar → Vern endringar. Skriv inn det rette passordet." #: protection.xhp msgctxt "" "protection.xhp\n" "hd_id3155113\n" "52\n" "help.text" msgid "Protecting Frames, Graphics, and OLE Objects" msgstr "Verna rammer, bilete og OLE-objekt" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3153703\n" "53\n" "help.text" msgid "You can protect the content, position and size of inserted graphics. The same applies to frames (in Writer) and OLE objects." msgstr "Du kan verna innhaldet i, plasseringa av og storleiken på bilete som vert sette inn. Det same gjeld for rammer (i Writer) og OLE-objekt." #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3147131\n" "54\n" "help.text" msgid "Turning on protection" msgstr "Slå på vern" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3150088\n" "55\n" "help.text" msgid "For example, for graphics inserted in Writer: Choose Format - Image - Options tab. Under Protect, mark Contents, Position and/or Size." msgstr "For eksempel for bilete sett inn i Writer: Vel fana Format → Bilete → Innstillingar. Merk av for Innhald, Plassering og/eller Storleik under Vern." #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3147510\n" "56\n" "help.text" msgid "Turning off protection" msgstr "Slå av vern" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3153657\n" "57\n" "help.text" msgid "For example, for graphics inserted in Writer: Choose Format - Image - Options tab. Under Protect, unmark as appropriate." msgstr "For eksempel for bilete sett inn i Writer: Vel fana Format → Bilete → Innstillingar. Fjern aktuelle merkingar i Vern." #: protection.xhp msgctxt "" "protection.xhp\n" "hd_id3152992\n" "58\n" "help.text" msgid "Protecting Drawing Objects and Form Objects" msgstr "Verna teikneobjekt og skjemaobjekt" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3166429\n" "59\n" "help.text" msgid "The draw objects that you insert into your documents with the Drawing toolbar can be protected from being accidentally moved or changed in size. You can do the same with form objects inserted with the Form Controls toolbar." msgstr "Teikneobjekt som vert sette inn i dokument ved hjelp av verktøylinja Teikning kan vernast mot flytting eller endring av storleiken. Du kan gjere det same med skjemaobjekt som er sett inn ved hjelp av verktøylinja Kontrollelement for skjema." #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3153226\n" "60\n" "help.text" msgid "Turning on protection" msgstr "Slå på vern" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3148815\n" "61\n" "help.text" msgid "Choose Format - Object - Position and Size - Position and Size tab. Mark the Position or Size check box." msgstr "Vel Format → Objekt → Posisjon og storleik → fana Posisjon og storleik. Marker avkryssingsfeltet Posisjon eller Storleik." #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3156289\n" "62\n" "help.text" msgid "Turning off protection" msgstr "Slå av vern" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id3154991\n" "63\n" "help.text" msgid "Choose Format - Object - Position and Size - Position and Size tab. Unmark the Position or Size check box." msgstr "Vel Format → Objekt → Posisjon og storleik → fana Posisjon og storleik. Fjern markeringa i avkryssingsfeltet Posisjon eller Storleik. " #: protection.xhp msgctxt "" "protection.xhp\n" "par_idN10B8C\n" "help.text" msgid "" msgstr "" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id4680928\n" "help.text" msgid "Protecting Content in %PRODUCTNAME Writer" msgstr "Verna innhald i %PRODUCTNAME Writer" #: protection.xhp msgctxt "" "protection.xhp\n" "par_id9014252\n" "help.text" msgid "Protecting Cells in %PRODUCTNAME Calc" msgstr "Verna celler i %PRODUCTNAME Calc" #: redlining.xhp msgctxt "" "redlining.xhp\n" "tit\n" "help.text" msgid "Recording and Displaying Changes" msgstr "Registrera og visa endringar" #: redlining.xhp msgctxt "" "redlining.xhp\n" "bm_id3150499\n" "help.text" msgid "marking changes highlighting changes changes; review function review function; recording changes example Track Changes, see review function" msgstr "markera endringar utheva endringar endringar; revisjonsfunksjonar revisjonsfunksjonar; registrera endringar, eksempel spora endringar, sjå revisjonsfunksjonar" #: redlining.xhp msgctxt "" "redlining.xhp\n" "hd_id3150499\n" "7\n" "help.text" msgid "Recording and Displaying Changes" msgstr "Registrera og visa endringar" #: redlining.xhp msgctxt "" "redlining.xhp\n" "par_id4013794\n" "help.text" msgid "The review function is available in %PRODUCTNAME for text documents and spreadsheet documents." msgstr "Revisjonsfunksjonen er tilgjengeleg i %PRODUCTNAME for bruk i tekstdokument og rekneark." #: redlining.xhp msgctxt "" "redlining.xhp\n" "par_id3153681\n" "2\n" "help.text" msgid "When several authors are working on the same text or spreadsheet, the review function records and displays who made the various changes. On the final edit of the document, it is then possible to look at each individual change and decide whether it should be accepted or rejected." msgstr "Når fleire forfattarar arbeider med den same teksten eller det same reknearket, vil revisjonsfunksjonen registrera og visa kven som har gjort dei ulike endringane. Når dokumentet skal gjerast ferdig, kan du sjå på kvar enkelt endring og avgjera om du vil godta eller avvisa ho." #: redlining.xhp msgctxt "" "redlining.xhp\n" "par_id3147008\n" "3\n" "help.text" msgid "For example: You are an editor and are delivering your latest report. But before publication the report must be read by the senior editor and the proofreader, and both will add their changes. The senior editor writes \"clarify\" after one paragraph and crosses out another entirely. The proofreader corrects the spelling of your document." msgstr "For eksempel, viss du er redaktør og leverer inn den nyaste rapporten din. Før rapporten vert publisert skal han lesast av både sjefsredaktøren og ein korrekturlesar, som begge gjer sine endringar. Sjefsredaktøren skriv «beskriv meir detaljert» etter eit avsnitt og stryk ut eit anna avsnitt. Korrekturlesaren har funne stavefeil i dokumentet og retta dei." #: redlining.xhp msgctxt "" "redlining.xhp\n" "par_id3150774\n" "4\n" "help.text" msgid "The edited document comes back to you, and you can incorporate or ignore the suggestions of the two reviewers." msgstr "Det redigerte dokumentet vert returnert til deg, slik at du kan inkludera eller sjå bort i frå endringane sjefsredaktøren og korrekturlesaren har gjort." #: redlining.xhp msgctxt "" "redlining.xhp\n" "par_id3146957\n" "5\n" "help.text" msgid "Let's say you also e-mailed a copy of the report to a good friend and colleague who has done research on a similar topic in the past. You asked for a few suggestions, and the document is now returned by e-mail with your colleague's suggestions." msgstr "Lat oss seia at du også har sendt ein kopi av rapporten i e-post til ein god ven og kollega, som har arbeidd med eit liknande emne tidlegare. Du har bede denne kollegaen leggja fram forslag til forbetringar og får eit redigert dokument tilbake via e-post." #: redlining.xhp msgctxt "" "redlining.xhp\n" "par_id3147088\n" "6\n" "help.text" msgid "As all your colleagues and the managers in your company work with $[officename], you can produce a final version of the document from the results you get back." msgstr "Fordi alle i firmaet brukar $[officename], kan du laga ei ferdig utgåve av dokumentet på grunnlag av tilbakemeldingane du får frå dei andre." #: redlining_accept.xhp msgctxt "" "redlining_accept.xhp\n" "tit\n" "help.text" msgid "Accepting or Rejecting Changes" msgstr "Godta eller avvisa endringar" #: redlining_accept.xhp msgctxt "" "redlining_accept.xhp\n" "bm_id3150247\n" "help.text" msgid "changes; accepting or rejectingreview function;accepting or rejecting changes" msgstr "endringar; godkjenn eller avvisrevisjonsfunksjon;godta eller avvise endringar" #: redlining_accept.xhp msgctxt "" "redlining_accept.xhp\n" "hd_id3150247\n" "23\n" "help.text" msgid "Accepting or Rejecting Changes" msgstr "Godta eller avvisa endringar" #: redlining_accept.xhp msgctxt "" "redlining_accept.xhp\n" "par_id1491134\n" "help.text" msgid "The review function is available in %PRODUCTNAME for text documents and spreadsheet documents." msgstr "Revisjonsfunksjonen er tilgjengeleg i %PRODUCTNAME for bruk i tekstdokument og rekneark." #: redlining_accept.xhp msgctxt "" "redlining_accept.xhp\n" "par_id1110200810120034\n" "help.text" msgid "In Writer text documents you can also accept or reject changes by choosing commands from the context menu." msgstr "I tekstdokument som er laga med Writer, kan du også godta eller avvisa endringar ved hjelp av val i sprettoppmenyen." #: redlining_accept.xhp msgctxt "" "redlining_accept.xhp\n" "par_id3147571\n" "24\n" "help.text" msgid "When you edit a document in which others have made changes, you can accept or reject the changes individually or all together." msgstr "Når du redigerer eit dokument som andre har gjort endringar i, kan du godta eller avvisa endringar kvar for seg, eller godta eller avvisa alle endringane på ei gong." #: redlining_accept.xhp msgctxt "" "redlining_accept.xhp\n" "par_id3147008\n" "25\n" "help.text" msgid "If you have put multiple copies of the document in circulation, first merge these into one document (see )." msgstr "Viss du har fleire kopiar av dokumentet i sirkulasjon, må du først fletta dei saman til eitt dokument (sjå )." #: redlining_accept.xhp msgctxt "" "redlining_accept.xhp\n" "par_id3153748\n" "26\n" "help.text" msgid "Open the document and choose Edit - Track Changes - Manage Changes. The Manage Changes dialog appears." msgstr "Vel Rediger → Endringar → Godta eller avvis. Dette vil opna dialogvindauget for å godta eller avvisa endringar." #: redlining_accept.xhp msgctxt "" "redlining_accept.xhp\n" "par_id3156346\n" "27\n" "help.text" msgid "Select a change on the List tab. The change is selected and displayed in the document and you can now enter your decision with one of the buttons." msgstr "Merk ei endring på fana Liste. Endringa vert merkt og vert vist i dokumentet. Nå kan du bruke knappane på fana til å velja kva du vil gjera med endringa." #: redlining_accept.xhp msgctxt "" "redlining_accept.xhp\n" "par_id3147209\n" "28\n" "help.text" msgid "If one author has modified another author's change, you will see the changes hierarchically arranged with a plus sign for opening up the hierarchy." msgstr "Viss ein forfattar har endra endringa til ein annan forfattar, vert endringane viste ordna hierarkisk, med eit plussteikn du kan bruka til å opna hierarkiet." #: redlining_accept.xhp msgctxt "" "redlining_accept.xhp\n" "par_id3148474\n" "29\n" "help.text" msgid "If the list of changes is too long, you can switch to the Filter tab in the dialog and specify that you only want to see the changes of certain authors, or only the changes of the last day, or that you want the list to be restricted in some other way." msgstr "Viss lista over endringar er for lang, kan du bytte til fana Filter i dialogvindauget og angje at du berre vil visa endringar frå bestemte forfattarar, berre endringar som er gjort den siste dagen eller bruka andre val til å avgrensa kva som vert vist i lista." #: redlining_accept.xhp msgctxt "" "redlining_accept.xhp\n" "par_id3143271\n" "42\n" "help.text" msgid "Color-coded entries display the result of the filter that is set. Entries in black can be accepted or rejected and match the filter criteria. Entries in blue do not themselves match the filter criteria, but have subentries that are included by the filter. Gray entries cannot be accepted or rejected and do not match the filter criterion. Green entries do match the filter but cannot be accepted or rejected." msgstr "Fargekoda element viser resultatet av filteret du bruker. Svarte element kan godtakast eller avvisast og er i samsvar med filterkriteriet. Blå element er ikkje i samsvar med filterkriteriet, men har underelement som er det. Grå element kan ikkje godtakast eller avvisast og er ikkje i samsvar med filterkriteriet. Grøne element er i samsvar med filterkriteriet, men kan ikke godtakast eller avvisast." #: redlining_doccompare.xhp msgctxt "" "redlining_doccompare.xhp\n" "tit\n" "help.text" msgid "Comparing Versions of a Document" msgstr "Samanlikna versjonar av eit dokument" #: redlining_doccompare.xhp msgctxt "" "redlining_doccompare.xhp\n" "bm_id3154788\n" "help.text" msgid "documents; comparingcomparisons;document versionsversions; comparing documentschanges;comparing to originalreview function; comparing documents" msgstr "dokument; samanliknesamanlikningar;dokumentversjonarversjonar; samanlikne dokumentendringar;samanlikne med originalrevisjonssfunksjon; samanlikne dokument" #: redlining_doccompare.xhp msgctxt "" "redlining_doccompare.xhp\n" "hd_id3154788\n" "32\n" "help.text" msgid "Comparing Versions of a Document" msgstr "Samanlikne versjonar av eit dokument" #: redlining_doccompare.xhp msgctxt "" "redlining_doccompare.xhp\n" "par_id4186223\n" "help.text" msgid "The review function is available in %PRODUCTNAME for text documents and spreadsheet documents." msgstr "Revisjonsfunksjonen er tilgjengeleg i %PRODUCTNAME for bruk i tekstdokument og rekneark." #: redlining_doccompare.xhp msgctxt "" "redlining_doccompare.xhp\n" "par_id3995178\n" "help.text" msgid "Imagine you have some co-authors or reviewers who collaborate with you writing your original document. One day you send out copies of your document to all reviewers. You ask them to edit the copy and send it back." msgstr "Lat oss seia at du skriv eit dokument i samarbeid med andre forforfattarar eller korrekturlesarar. Ein dag sender du kopiar av dokumentet til alle korrekturlesarane og bed dei redigera denne kopien og senda han tilbake." #: redlining_doccompare.xhp msgctxt "" "redlining_doccompare.xhp\n" "par_id9948423\n" "help.text" msgid "Normally, the reviewers enable change tracking by Edit - Track Changes - Record Changes and you can easily see the changes." msgstr "Normalt vil korrekturlesaren opna for å spora endringane ved å slå på Rediger → Endringar → Registrer slik at du lett kan sjå endringane." #: redlining_doccompare.xhp msgctxt "" "redlining_doccompare.xhp\n" "par_id3155421\n" "33\n" "help.text" msgid "If one of the authors has made changes to a document without recording them, you can compare the changed document to your original document." msgstr "Viss ein av forfattarane har gjort endringar i eit dokument utan å slå på opptak, kan du samanlikne det endra dokumentet med originaldokument ditt." #: redlining_doccompare.xhp msgctxt "" "redlining_doccompare.xhp\n" "par_id3153087\n" "35\n" "help.text" msgid "Open the reviewer's document and then choose Edit - Compare Document." msgstr "Opna dokumentet frå korrekturlesaren og vel Rediger → Samanlikn dokument." #: redlining_doccompare.xhp msgctxt "" "redlining_doccompare.xhp\n" "par_id4208807\n" "help.text" msgid "You should always start with opening the newer document and compare it with the older document." msgstr "Du bør alltid byrja med å opna det nyaste dokumentet og samanlikne det med det eldre dokumentet." #: redlining_doccompare.xhp msgctxt "" "redlining_doccompare.xhp\n" "par_id3145315\n" "36\n" "help.text" msgid "A file selection dialog appears. Select your older original document and confirm the dialog." msgstr "Det kjem fram eit dialogvindauge for filval. Merk det eldre originaldokumentet og godkjenn." #: redlining_doccompare.xhp msgctxt "" "redlining_doccompare.xhp\n" "par_id3149762\n" "37\n" "help.text" msgid "%PRODUCTNAME combines both documents into the reviewer's document. All text passages that occur in the reviewer's document but not in the original are identified as having been inserted, and all text passages that got deleted by the reviewer are identified as deletions." msgstr "%PRODUCTNAME set saman begge dokumenta inne i dokumentet frå korrekturlesaren. All tekst som finst i korrekturlesaren sitt dokument, men ikkje i originalen, vert identifisert som innsettingar og all tekst som er sletta av korrekturlesaren vert identifisert som slettingar." #: redlining_doccompare.xhp msgctxt "" "redlining_doccompare.xhp\n" "par_id3145674\n" "38\n" "help.text" msgid "You can now accept or reject the insertions and deletions. At the end you may save the reviewer's document as a new original with a new name." msgstr "Nå kan du godta «innsettingane» og «slettingane». Til slutt kan du lagra korrekturlesaren sitt dokument som ein ny original med eit nytt namn." #: redlining_docmerge.xhp msgctxt "" "redlining_docmerge.xhp\n" "tit\n" "help.text" msgid "Merging Versions" msgstr "Fletta versjonar" #: redlining_docmerge.xhp msgctxt "" "redlining_docmerge.xhp\n" "bm_id3154230\n" "help.text" msgid "documents; mergingmerging; documentsversions;merging document versions" msgstr "dokument; flettafletta; dokumentversjonar;fletta dokumentversjonar" #: redlining_docmerge.xhp msgctxt "" "redlining_docmerge.xhp\n" "hd_id3154230\n" "17\n" "help.text" msgid "Merging Versions" msgstr "Fletta versjonar" #: redlining_docmerge.xhp msgctxt "" "redlining_docmerge.xhp\n" "par_id2136295\n" "help.text" msgid "The review function is available in %PRODUCTNAME for text documents and spreadsheet documents." msgstr "Revisjonsfunksjonen er tilgjengeleg i %PRODUCTNAME for bruk i tekstdokument og rekneark." #: redlining_docmerge.xhp msgctxt "" "redlining_docmerge.xhp\n" "par_id3153049\n" "19\n" "help.text" msgid "When a document has been edited by more than one person, it is possible to merge the edited copies into the original. The only requirement is that the documents differ only and exclusively in the recorded changes - all other original text must be identical." msgstr "Når eit dokument er redigert av meir enn ein person, er det mogleg å fletta dei redigerte kopiane inn i originalen. Det einaste kravet er at alle skilnadane i dokumenta er registrerte endringar. All anna tekst i originalen må vera identisk." #: redlining_docmerge.xhp msgctxt "" "redlining_docmerge.xhp\n" "par_id3152425\n" "20\n" "help.text" msgid "Open the original document into which you want to merge all copies." msgstr "Opna originaldokumentet du vil fletta alle kopiane inn i." #: redlining_docmerge.xhp msgctxt "" "redlining_docmerge.xhp\n" "par_id3149177\n" "21\n" "help.text" msgid "Choose Edit - Track Changes - Merge Document. A file selection dialog appears." msgstr "Vel Rediger → Endringar → Flett dokument. Det kjem opp eit vindauge der du kan velja fil." #: redlining_docmerge.xhp msgctxt "" "redlining_docmerge.xhp\n" "par_id3147576\n" "23\n" "help.text" msgid "Select the copy of the document from the dialog. If there have been no subsequent changes to the original document, the copy is merged into the original." msgstr "Merk kopien av dokumentet i dialogvindauget. Viss det ikkje er gjort endringar i originaldokumentet sidan sist, vert kopien fletta inn i originalen." #: redlining_docmerge.xhp msgctxt "" "redlining_docmerge.xhp\n" "par_id3149182\n" "24\n" "help.text" msgid "If changes have been made to the original document, an error dialog appears that informs you that the merge is unsuccessful." msgstr "Viss det er gjort endringar i originaldokumentet, kjem det fram eit dialogvindauge med ei melding om at flettinga var mislukka." #: redlining_docmerge.xhp msgctxt "" "redlining_docmerge.xhp\n" "par_id3154749\n" "22\n" "help.text" msgid "After you merge the documents you will see the recorded changes from the copy in the original document." msgstr "Når du har fletta dokumenta, vert dei registrerte endringane frå kopien viste i originaldokumentet." #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "tit\n" "help.text" msgid "Recording Changes" msgstr "Registrera endringar" #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "bm_id3155364\n" "help.text" msgid "changes; recording recording; changes comments; on changes review function;tracking changes" msgstr "endringar; registreraregistrera; endringarkommentarar; til endringarrevisjonsfunksjon;spore endringar" #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "hd_id3155364\n" "7\n" "help.text" msgid "Recording Changes" msgstr "Registrera endringar" #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "par_id7271645\n" "help.text" msgid "The review function is available in %PRODUCTNAME for text documents and spreadsheet documents." msgstr "Revisjonsfunksjonen er tilgjengeleg i %PRODUCTNAME for bruk i tekstdokument og rekneark." #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "par_id3145669\n" "8\n" "help.text" msgid "Not all changes are recorded. For example, the changing of a tab stop from align left to align right is not recorded. However, all usual changes made by a proofreader are recorded, such as additions, deletions, text alterations, and usual formatting." msgstr "Ikkje alle endringane vert registrerte. For eksempel vert det ikkje registrert om ein venstretabulator vert endra til ein høgretabulator. Men alle endringar som ein korrekturlesar gjer til vanleg vert registrerte. Dette gjeld mellom anna endringar i formatering og tekst som vert lagt til, sletta eller endra." #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "par_id3147088\n" "17\n" "help.text" msgid "1." msgstr "1." #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "par_id3149095\n" "9\n" "help.text" msgid "To start recording changes, open the document to be edited and choose Edit - Track Changes and then choose Record Changes." msgstr "Du byrjar å registrera endringar ved å opna dokumentet som skal redigerast og velja Rediger → Endringar og deretter velja Registrer." #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "par_id3154749\n" "18\n" "help.text" msgid "2." msgstr "2." #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "par_id3163802\n" "10\n" "help.text" msgid "Now start making your changes. You will note that all new text passages that you enter are underlined in color, while all text that you delete remains visible but is crossed out and shown in color." msgstr "Nå kan du byrja å gjera endringar. Du vil leggja merke til at all ny tekst du skriv inn vert understreka med ein farge, medan all tekst du slettar, framleis er synleg, men vert gjennomstreka med same fargen." #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "par_id3152349\n" "19\n" "help.text" msgid "3." msgstr "3." #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "par_id3149578\n" "11\n" "help.text" msgid "If you move to a marked change with the mouse pointer, you will see a reference to the type of change, the author, date and time of day for the change in the Help Tip. If the Extended Tips are also enabled, you will also see any available comments on this change." msgstr "Viss du held musepeikaren over ei merkt endring, vil du sjå ein referanse til typen endring, forfattaren, dato og klokkeslett for endringa i hjelpetipset. Viss utvida tips også er slått på, kan du sjå eventuelle merknadar til endringa." #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "par_id3156119\n" "12\n" "help.text" msgid "Changes in a spreadsheet document are highlighted by a border around the cells; when you point to the cell you can see more detailed information on this change in the Help Tip." msgstr "Endringar i eit rekneark vert utheva med ein kant rundt celler med endringar. Når du held musepeikaren over ei endra celle, kjem det opp meir detaljert informasjon om denne endringa i eit hjelpetips." #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "par_id3148473\n" "13\n" "help.text" msgid "You can enter a comment on each recorded change by placing the cursor in the area of the change and then choosing Edit - Track Changes - Comment on Change. In addition to Extended Tips, the comment is also displayed in the list in the Manage Changes dialog." msgstr "Du kan skriva inn ein merknad til kvar registrert endring ved å plassera musepeikaren i området som inneheld endringa og deretter velja Rediger → Endringar → Merknad. Eventuelle merknader vert viste både i Utvida tips og i lista som vert vist i dialogvindauget Godta eller avvis endringar." #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "par_id3153542\n" "14\n" "help.text" msgid "To stop recording changes, choose Edit - Track Changes - Record Changes again. The check mark is removed and you can now save the document." msgstr "Du kan stoppe registreringa av endringar ved å velje Rediger → Endringar → Registrer igjen. Hakemerket ved sida av valet vert fjerna og nå kan du lagra dokumentet." #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "par_id3153627\n" "15\n" "help.text" msgid "In a text document, you can highlight all lines that you have changed with an additional colored marking. This can be in the form of a red line in the margin, for example." msgstr "I eit tekstdokument kan du merka alle linjene du har gjort endringar i, med ei ekstra fargemerking. Dette kan for eksempel visast med ein raud strek i margen." #: redlining_enter.xhp msgctxt "" "redlining_enter.xhp\n" "par_id3147530\n" "16\n" "help.text" msgid "To change the settings for tracking changes, choose %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME Writer - Changes or on the %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME Calc - Changes." msgstr "Du kan endra innstillingane for sporing av endringar ved å velja %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → %PRODUCTNAME WriterEndringar eller %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → %PRODUCTNAME CalcEndringar." #: redlining_navigation.xhp msgctxt "" "redlining_navigation.xhp\n" "title\n" "help.text" msgid "Navigating Changes" msgstr "Navigera gjennom endringar" #: redlining_navigation.xhp msgctxt "" "redlining_navigation.xhp\n" "bm_redlining_navigation\n" "help.text" msgid "changes; navigating review function; navigating changes" msgstr "endringar; navigerarevisjonsfunksjon; navigera i endringar" #: redlining_navigation.xhp msgctxt "" "redlining_navigation.xhp\n" "par_id3153880\n" "help.text" msgid "Navigating Changes" msgstr "Navigera gjennom endringar" #: redlining_navigation.xhp msgctxt "" "redlining_navigation.xhp\n" "par_id3153881\n" "help.text" msgid "This feature is Writer-specific." msgstr "Denne funksjonen er spesiell for Writer." #: redlining_navigation.xhp msgctxt "" "redlining_navigation.xhp\n" "par_id3153882\n" "help.text" msgid "There are two available commands to navigate changes in a Writer document:" msgstr "Det finst to kommandoar for å navigera gjennom endringar i eit Writer-dokument:" #: redlining_navigation.xhp msgctxt "" "redlining_navigation.xhp\n" "par_id3153883\n" "help.text" msgid "Edit - Track Changes - Next Change: Jumps to and selects the next change in the document, if any." msgstr "Rediger → Endringar → Neste endring: Går til og merkar den neste endringa i dokumentet viss det er fleire endringar." #: redlining_navigation.xhp msgctxt "" "redlining_navigation.xhp\n" "par_id3153884\n" "help.text" msgid "Edit - Track Changes - Previous Change: Jumps to and selects the previous change in the document, if any." msgstr "Rediger → Endringar → Førre endring: Går til og merkar den førre endringa i dokumentet viss denne finst." #: redlining_navigation.xhp msgctxt "" "redlining_navigation.xhp\n" "par_id3153885\n" "help.text" msgid "Using these commands in conjunction with the Accept Change and Reject Change commands allows navigating, accepting and rejecting changes without invoking the Edit - Track Changes - Manage Changes dialog." msgstr "Bruk desse kommandoane saman med kommandoane Godta og Forkast gjer at du kan navigera, akseptera eller forkasta endringar utan å aktivera dialogvindauget Rediger → Endringar → Godta eller avvis." #: redlining_protect.xhp msgctxt "" "redlining_protect.xhp\n" "tit\n" "help.text" msgid "Protecting Records" msgstr "Verna postar" #: redlining_protect.xhp msgctxt "" "redlining_protect.xhp\n" "bm_id3159201\n" "help.text" msgid "changes; protectingprotecting; recorded changesrecords; protectingreview function;protecting records" msgstr "endringar; vernaverna; registrerte endringaropptak; vernarevisjonsfunksjon;verna opptak" #: redlining_protect.xhp msgctxt "" "redlining_protect.xhp\n" "hd_id3159201\n" "1\n" "help.text" msgid "Protecting Changes " msgstr "Verna endringar " #: redlining_protect.xhp msgctxt "" "redlining_protect.xhp\n" "par_id1631824\n" "help.text" msgid "The review function is available in %PRODUCTNAME for text documents and spreadsheet documents." msgstr "Revisjonsfunksjonen er tilgjengeleg i %PRODUCTNAME for bruk i tekstdokument og rekneark." #: redlining_protect.xhp msgctxt "" "redlining_protect.xhp\n" "par_id3154751\n" "2\n" "help.text" msgid "To protect the changes made in a document during editing, choose Edit - Track Changes - Protect Changes. To turn off the function or to accept or reject changes it is necessary to enter the correct password first." msgstr "Vel Rediger → Endringar → Vern endringar for å verna endringar som er gjort i dokumentet under redigeringa. For å slå av denne funksjonen må du skriva inn det rette passordet." #: redlining_protect.xhp msgctxt "" "redlining_protect.xhp\n" "par_id3147088\n" "3\n" "help.text" msgid "Choose Protect Changes. This opens the Password dialog." msgstr "Vel Vern endringar. Dette opnar eit dialogvindauge for Passord." #: redlining_protect.xhp msgctxt "" "redlining_protect.xhp\n" "par_id3153345\n" "4\n" "help.text" msgid "Enter a password consisting of at least one character and confirm it. Click OK." msgstr "Skriv inn eit passord med minst eitt teikn og trykk OK." #: redlining_versions.xhp msgctxt "" "redlining_versions.xhp\n" "tit\n" "help.text" msgid "Version Management" msgstr "Versjonshandtering" #: redlining_versions.xhp msgctxt "" "redlining_versions.xhp\n" "bm_id3154230\n" "help.text" msgid "versions; of a documentdocuments; version managementversion management" msgstr "versjonar; av eit dokumentdokument; versjonsstyringversjonshandtering" #: redlining_versions.xhp msgctxt "" "redlining_versions.xhp\n" "hd_id3154230\n" "43\n" "help.text" msgid "Version Management" msgstr "Versjonshandtering" #: redlining_versions.xhp msgctxt "" "redlining_versions.xhp\n" "par_id3153394\n" "40\n" "help.text" msgid "The File menu contains a Versions command that enables you to save multiple versions of a document in the same file." msgstr "Fil-menyen inneheld valet Versjonar som let deg lagra fleire versjonar av eit dokument i den same fila." #: redlining_versions.xhp msgctxt "" "redlining_versions.xhp\n" "par_id3149399\n" "44\n" "help.text" msgid "You can choose to view individual versions of a document, or you can display the differences between versions with color markings." msgstr "Du kan velja å visa ulike versjonar av eit dokument kvar for seg, eller du kan visa skilnadane mellom versjonane med fargemerking." #: redlining_versions.xhp msgctxt "" "redlining_versions.xhp\n" "par_id3149811\n" "45\n" "help.text" msgid "In the dialog to open a document, you can select from a combo box which version of this document you want to open." msgstr "I dialogvindauget som vert brukt til å opna eit dokument er det eit kombinasjonsfelt som kan brukast til å velja kva versjon av dokumentet som skal opnast." #: round_corner.xhp msgctxt "" "round_corner.xhp\n" "tit\n" "help.text" msgid "Creating Round Corners" msgstr "Laga avrunda hjørne" #: round_corner.xhp msgctxt "" "round_corner.xhp\n" "bm_id3150040\n" "help.text" msgid "corner roundingsrectangles with round cornerslegends;rounding cornersround cornerscustomizing;round corners" msgstr "runding av hjørnerektangel med avrunda hjørneforklaringsbokser;avrunding av hjørneavrunda hjørnetilpassing;runde hjørne" #: round_corner.xhp msgctxt "" "round_corner.xhp\n" "hd_id3150040\n" "6\n" "help.text" msgid "Creating Round Corners" msgstr "Laga avrunda hjørne" #: round_corner.xhp msgctxt "" "round_corner.xhp\n" "par_id3156136\n" "4\n" "help.text" msgid "When you insert a rectangle or a callout box using the drawing functions and activate the Points icon on the Drawing toolbar, you see a small frame at the upper left corner of the object. The frame indicates the amount by which the corners are rounded. When the frame is positioned at the top left corner, no rounding occurs. When the frame is positioned on the handle centered at the top of the object, the corners are rounded as much as possible. You adjust the degree of rounding by moving the frame between these two positions." msgstr "Når du set inn eit rektangel eller ein forklaringsboks ved hjelp av teiknefunksjonane og slår på Punkt i verktøylinja Teikning, vert det vist ei lita ramme ved det øvre, venstre hjørne av objektet. Denne ramma viser kor mykje hjørna er avrunda. Når ramma er plassert i det øvste, venstre hjørnet, vert det ikkje brukt avrunding. Når ramma er plassert på handtaket på midten øvst på objektet, er hjørna avrunda mest mogleg. Du kan tilpassa kor stor avrundinga skal vera ved å flytta ramma mellom desse to ytterpunkta." #: round_corner.xhp msgctxt "" "round_corner.xhp\n" "par_id3156426\n" "help.text" msgid "Mouse pointer as hand" msgstr "Musepeikaren som ei hand" #: round_corner.xhp msgctxt "" "round_corner.xhp\n" "par_id3148539\n" "5\n" "help.text" msgid "If you place the cursor on the box it changes to a hand symbol. You can now drag the box to change the amount of rounding. An outline shows a preview of the result." msgstr "Viss du plasserer musepeikaren over boksen, vert han endra til ei hand. Nå kan du dra feltet for å bruka større eller mindre avrunding. Eit omriss gjev ei førehandsvising av resultatet." #: scripting.xhp msgctxt "" "scripting.xhp\n" "tit\n" "help.text" msgid "Scripting %PRODUCTNAME" msgstr "Bruka skript i %PRODUCTNAME" #: scripting.xhp msgctxt "" "scripting.xhp\n" "bm_id5277565\n" "help.text" msgid "assigning scripts programming;scripting form controls;assigning macros pictures;assigning macros hyperlinks;assigning macros shortcut keys;assigning macros controls;assigning macros (Basic) menus;assigning macros events;assigning scripts" msgstr "bruka skript programmere;skript skjemakontrollelement;bruka makroar bilete;bruka makroar hyperlenkjer;bruka makroar snarvegstastar;bruka makroar kontrollelement;bruka makroar (Basic) menyar;bruka makroar hendingar;bruka skript" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN1070A\n" "help.text" msgid "Assigning Scripts in %PRODUCTNAME" msgstr "Bruka skript i %PRODUCTNAME" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10728\n" "help.text" msgid "You can assign custom scripts (macros) to menu items, icons, dialog controls, and events in %PRODUCTNAME." msgstr "Du kan bruka sjølvvalde skript (makroar) til menyoppføringar, ikon, kontrollelement i dialogvindauge og hendingar i %PRODUCTNAME." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN1072B\n" "help.text" msgid "%PRODUCTNAME internally supports the following scripting languages:" msgstr "%PRODUCTNAME har intern støtte for desse skriptspråka:" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10731\n" "help.text" msgid "%PRODUCTNAME Basic" msgstr "%PRODUCTNAME Basic" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10739\n" "help.text" msgid "JavaScript" msgstr "JavaScript" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN1073D\n" "help.text" msgid "BeanShell" msgstr "BeanShell" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_id6797082\n" "help.text" msgid "Python" msgstr "Python" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN1091F\n" "help.text" msgid "In addition, developers can use high-level languages, for example Java programming language, to control %PRODUCTNAME externally. The API reference is online at api.libreoffice.org." msgstr "I tillegg kan utviklarane bruka høgnivåspråk som for eksempel Java til å kontrollera %PRODUCTNAME eksternt. API-referansen finst på Internett på api.libreoffice.org." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10751\n" "help.text" msgid "To assign a script to a new menu entry" msgstr "Slik tildeler du eit skript til ei ny menyoppføring" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10758\n" "help.text" msgid "Choose Tools - Customize, and click the Menus tab." msgstr "Vel Verktøy → Tilpass og trykk på fana Verktøylinjer." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN1093D\n" "help.text" msgid "Click Add." msgstr "Trykk Legg til." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10760\n" "help.text" msgid "In the Category list box, scroll down and open the \"%PRODUCTNAME Macros\" entry." msgstr "Bla du ned til og opna oppføringa «%PRODUCTNAME-makroar» i lista Kategori." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10768\n" "help.text" msgid "You see entries for \"%PRODUCTNAME Macros\" (scripts in the share directory of your %PRODUCTNAME installation), \"My Macros\" (scripts in the user directory), and the current document. Open any one of them to see the supported scripting languages." msgstr "Du kan sjå oppføringar for «OpenOffice.org-makroar» (skript i den delte mappa «share» i installasjonsmappa til %PRODUCTNAME), «Mine makroar» (skript i brukarmappa «user»), og det gjeldande dokumentet. Opna ei av dei for å sjå kva skriptspråk som er støtta." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN1076C\n" "help.text" msgid "Open any scripting language entry to see the available scripts. Select a script." msgstr "Opna oppføringa til eit skriptspråk for å sjå kva skript som er tilgjengelege. Vel eit skript." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10770\n" "help.text" msgid "A list of the script functions appears in the Commands list box. Select a function." msgstr "Listeboksen Eksisterande makroar viser ei liste med skriptfunksjonar. Vel ein funksjon." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10778\n" "help.text" msgid "Click Add to create a new menu assignment. The new menu entry appears in the Entries list box." msgstr "Trykk på Legg til for å laga ei ny menytildeling. Den nye menyoppføringa vert då vist i listeboksen Postar." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10783\n" "help.text" msgid "To assign a script to a key combination" msgstr "Slik tildeler du eit skript til ein snartast" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10787\n" "help.text" msgid "Choose Tools - Customize - Keyboard." msgstr "Vel Innstillingar → Tilpass → Tastatur." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10A59\n" "help.text" msgid "In the Category list box, scroll down and open the \"%PRODUCTNAME Macros\" entry." msgstr "Bla deg ned til og opna oppføringa «%PRODUCTNAME-makroar» i lista Kategori." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10A61\n" "help.text" msgid "You see entries for \"%PRODUCTNAME Macros\" (scripts in the share directory of your %PRODUCTNAME installation), \"My Macros\" (scripts in the user directory), and the current document. Open any one of them to see the supported scripting languages." msgstr "Du kan sjå oppføringar for «OpenOffice.org-makroar» (skript i den delte mappa «share» i installasjonsmappa til %PRODUCTNAME), «Mine makroar» (skript i brukarmappa «user»), og det gjeldande dokumentet. Opna ei av dei for å sjå kva skriptspråk som er støtta." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10A65\n" "help.text" msgid "Open any scripting language entry to see the available scripts. Select any script." msgstr "Opna oppføringa til eit skriptspråk for å sjå kva skript som er tilgjengelege. Vel eit skript." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10A69\n" "help.text" msgid "A list of the script functions will appear in the Commands list box. Select any function." msgstr "Det vert vist ei liste med skriptfunksjonar i listeboksen Eksisterande makroar. Vel ein funksjon." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10A71\n" "help.text" msgid "Click the option button for %PRODUCTNAME or Writer (or whichever application is currently open)." msgstr "Trykk på radioknappen for %PRODUCTNAME eller Writer (eller eit anna program som er ope)." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10A74\n" "help.text" msgid "Selecting the option button sets the scope of the new key combination to be applicable in all of %PRODUCTNAME or only in documents of the current module." msgstr "Valknappen bestemmer om den nye tastekombinasjonen skal gjelda i heile %PRODUCTNAME eller berre for dokument i det gjeldande programmet." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10A78\n" "help.text" msgid "Select a key combination from the Shortcut keys list box and click Modify." msgstr "Merk ein tastekombinasjon i listeboksen Snøggtastar og trykk på Endra." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN1078A\n" "help.text" msgid "To assign a script to an event" msgstr "Slik tildelar du eit skript til ei hending" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN1078E\n" "help.text" msgid "Choose Tools - Customize - Events." msgstr "Vel Verktøy → Tilpass → Hendingar." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10A16\n" "help.text" msgid "Click Macro button." msgstr "Klikk på knappen Makro." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10A9E\n" "help.text" msgid "In the Library list box, scroll down and open the \"%PRODUCTNAME Macros\" entry." msgstr "Bla nedover i listeboksen Makroar og finn og opna oppføringa «%PRODUCTNAME-makroar»." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10AA6\n" "help.text" msgid "You see entries for \"%PRODUCTNAME Macros\" (scripts in the share directory of your %PRODUCTNAME installation), \"My Macros\" (scripts in the user directory), and the current document. Open any one of them to see the supported scripting languages." msgstr "Du kan sjå oppføringar for «%PRODUCTNAME-makroar» (skript i den delte mappa «share» i installasjonsmappa til %PRODUCTNAME), «Mine makroar» (skript i brukarmappa «user») og det gjeldande dokumentet. Opna ei av dei for å sjå kva skriptspråk som er støtta." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10AAA\n" "help.text" msgid "Open any scripting language entry to see the available scripts. Select any script." msgstr "Opna oppføringa til eit av skriptspråka for å sjå kva skript som er tilgjengelege. Merk eit av skripta." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10AAE\n" "help.text" msgid "A list of the script functions will appear in the Assigned Action list box. Select any function." msgstr "Ei liste med skriptfunksjonar kjem fram i listeboksen Eksisterande makroar. Merk ein av funksjonane." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10AB6\n" "help.text" msgid "Select to save in %PRODUCTNAME or current document." msgstr "Vel om du vil lagra i %PRODUCTNAME eller i det gjeldande dokumentet." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10AB9\n" "help.text" msgid "This sets the scope of the new event assignment to be applicable in all of %PRODUCTNAME or only in documents of the current module." msgstr "Dette bestemmer om den nye tildelinga skal gjelda i heile %PRODUCTNAME eller berre for dokument i den gjeldande modulen." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10ABD\n" "help.text" msgid "Select an event from the list and click OK." msgstr "Merk ei hending i lista og trykk OK." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10791\n" "help.text" msgid "To assign a script to an event for an embedded object" msgstr "Slik tildeler du eit skript til ei hending for eit innebygd objekt" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10795\n" "help.text" msgid "Select the embedded object, for example a chart, in your document." msgstr "Merk det innebygde objektet, for eksempel eit diagram, i dokumentet." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10ADB\n" "help.text" msgid "Choose Format - Frame/Object - Macro." msgstr "Vel Format → Ramme/Objekt → Makro." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10ADF\n" "help.text" msgid "In the Macros list box, open the %PRODUCTNAME Scripts entry." msgstr "Opna %PRODUCTNAME-skript-oppføringa i listeboksen Makroar." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10AE7\n" "help.text" msgid "You see entries for share (scripts in the share directory of your %PRODUCTNAME installation), user (scripts in the user directory), and the current document. Open any one of them to see the supported scripting languages." msgstr "Du kan sjå oppføringar for «share» (skript i mappa «share» i installasjonsmappa til %PRODUCTNAME), «user» (skript i brukarmappa), og det gjeldande dokumentet. Opna ei av dei for å sjå kva skriptspråk som er støtta." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10AEB\n" "help.text" msgid "Open any scripting language entry to see the available scripts. Select any script." msgstr "Opna oppføringa til eit av skriptspråka for å sjå kva skript som er tilgjengelege. Merk eit av skripta." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10AEF\n" "help.text" msgid "A list of the script functions will appear in the Existing macros in list box. Select any function." msgstr "Ei liste med skriptfunksjonar kjem fram i listeboksen Eksisterande makroar. Merk ein av funksjonane." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10AF7\n" "help.text" msgid "Select an event from the list and click OK." msgstr "Merk ei hending på lista og trykk OK." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10798\n" "help.text" msgid "To assign a script to a hyperlink" msgstr "Slik tildeler du eit skript til ei hyperlenkje" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN1079C\n" "help.text" msgid "Position the cursor inside the hyperlink." msgstr "Plasser markøren inni hyperlenkja." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10B15\n" "help.text" msgid "Choose Insert - Hyperlink." msgstr "Vel Set inn → Hyperlenkje" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10B19\n" "help.text" msgid "Click the Events button." msgstr "Klikk på knappen Hendingar." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10B21\n" "help.text" msgid "Select and assign as stated above." msgstr "Merk og tildel som forklart ovanfor." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN1079F\n" "help.text" msgid "To assign a script to a graphic" msgstr "Slik tildeler du eit skript til eit bilete" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN107A3\n" "help.text" msgid "Select the graphic in your document." msgstr "Merk biletet i dokumentet." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10B3B\n" "help.text" msgid "Choose Format - Image - Macro." msgstr "Vel Format → Bilete → Makro." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10B3F\n" "help.text" msgid "Select and assign as stated above." msgstr "Merk og tildel som forklart ovanfor. " #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN107A6\n" "help.text" msgid "To assign a script to a form control" msgstr "Slik tildeler du eit skript til eit skjemakontrollelement " #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN107AA\n" "help.text" msgid "Insert a form control, for example a button: Open the Form Controls toolbar, click the Push Button icon, drag open a button on your document." msgstr "Set inn eit skjemakontrollelement, for eksempel ein knapp. Opna verktøylinja for skjemakontroll, klikk på knappen Trykknapp og dra ein knapp til dokumentet ditt." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10B59\n" "help.text" msgid "With the form control selected, click Control on the Form Controls toolbar." msgstr "Med skjemakontrollen merkt, klikk Kontroll på verktøylinja for skjemakontroll." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10B5D\n" "help.text" msgid "Click the Events tab of the Properties dialog." msgstr "Klikk på fana Hendingar i dialogvindauget for eigenskapar." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10B61\n" "help.text" msgid "Click one of the ... buttons to open a dialog where you can assign a script to the selected event." msgstr "Klikk på ein av ...-knappane for å opna eit dialogvindauge der du kan tildele eit skript til den merkte hendinga." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN107AD\n" "help.text" msgid "To assign a script to a control in the %PRODUCTNAME Basic dialog" msgstr "Slik tildeler du eit skript til eit kontrollelement i %PRODUCTNAME Basic-dialogvindauget" #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN107B1\n" "help.text" msgid "Open the %PRODUCTNAME Basic dialog editor, then create a dialog with a control on it." msgstr "Opna dialogvindaugeutforminga i %PRODUCTNAME Basic og lag eit dialogvindauge med eitt kontrollelement." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10B7F\n" "help.text" msgid "Right-click the control, then choose Properties." msgstr "Høgreklikk og vel Eigenskapar." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10B87\n" "help.text" msgid "Click the Events tab of the Properties dialog." msgstr "Klikk på fana Hendingar i dialogvindauget for eigenskapar." #: scripting.xhp msgctxt "" "scripting.xhp\n" "par_idN10B8B\n" "help.text" msgid "Click one of the ... buttons to open a dialog where you can assign a script to the selected event." msgstr "Klikk på ein av ...-knappane for å opna eit dialogvindauge der du kan tildele eit skript til den merkte hendinga. " #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "tit\n" "help.text" msgid "Inserting Protected Spaces, Hyphens and Conditional Separators" msgstr "Setja inn verna mellomrom, orddeling og betinga skiljeteikn" #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "bm_id3155364\n" "help.text" msgid "protected spaces;insertingspaces; inserting protected spaceshyphens;inserting customconditional separatorsseparators; conditionaldashesnon-breaking dashesreplacing;dashesprotected dashesexchanging, see also replacing" msgstr "verna mellomrom;setja innmellomrom; setja inn verna mellomromorddelingar;setja inn tilpassabetinga skiljeteiknskiljeteikn; betingatankestrekarharde tankestrekarbyta ut;tankestrekarverna tankestrekarutveksla, sjå også byta ut" #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "hd_id3155364\n" "30\n" "help.text" msgid "Inserting Protected Spaces, Hyphens and Conditional Separators" msgstr "Setja inn verna mellomrom, orddeling og betinga skiljeteikn" #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "hd_id3156136\n" "61\n" "help.text" msgid "Non-breaking spaces" msgstr "Harde mellomrom" #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "par_id3147008\n" "31\n" "help.text" msgid "To prevent two words from being separated at the end of a line, hold down the Command key Ctrl key and the Shift key when you type a space between the words." msgstr "For å hindr to ord i å verta skilde ved slutten av ei linje, trykk på CmdCtrl når du set inn eit mellomrom mellom orda." #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "par_id5749687\n" "help.text" msgid "In Calc, you cannot insert non-breaking spaces." msgstr "Du kan ikkje setja inn harde mellomrom i Calc." #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "hd_id3146957\n" "62\n" "help.text" msgid "Non-breaking dash" msgstr "Hard bindestrek" #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "par_id3148538\n" "32\n" "help.text" msgid "An example of a non-breaking dash is a company name such as A-Z. Obviously you would not want A- to appear at the end of a line and Z at the beginning of the next line. To solve this problem, press Shift+Ctrl+ minus sign. In other words, hold down the Shift and Ctrl keys and press the minus key." msgstr "Eit eksempel på bruk av hard bindestrek er eit firmanamn som A-Z. Sjølvsagt ønskjer du ikkje å visa A- ved slutten av linja og Z ved byrjinga av den neste. For å unngå dette, held du nede tastane Shift og Ctrl medan du trykker minusteiknet." #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "hd_id3163802\n" "65\n" "help.text" msgid "Hyphen, dash" msgstr "Bindestrek, tankestrek" #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "par_id3154749\n" "66\n" "help.text" msgid "In order to enter longer dashes, you can find under Tools - AutoCorrect Options- Options the Replace dashes option. This option replaces one or two minus signs under certain conditions with an en-dash or an em-dash (see $[officename] Help)." msgstr "For å setja inn lengre strekar kan du under Verktøy → Innstillingar for autoretting i fana Val finna innstillinga Byt ut bindestrek med tankestrek på rette stader Denne innstillinga byter i visse tilfelle eitt eller to minusteikn med ein kort eller ein lang bindestrek (sjå $[officename] Hjelp)." #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "par_id3153561\n" "67\n" "help.text" msgid "For additional replacements see the replacements table under Tools - AutoCorrect Options- Replace. Here you can, among other things, replace a shortcut automatically by a dash, even in another font." msgstr "For fleire utbytingar, sjå erstatningstabellen under Verktøy → Innstillingar for autorettingByt ut. Her kan du mellom anna automatisk byta ein snarveg med ein bindestrek." #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "hd_id3153825\n" "63\n" "help.text" msgid "Definite separator" msgstr "Bestemt skiljeteikn" #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "par_id3154306\n" "60\n" "help.text" msgid "To support automatic hyphenation by entering a separator inside a word yourself, use the keys Command Ctrl+minus sign. The word is separated at this position when it is at the end of the line, even if automatic hyphenation for this paragraph is switched off." msgstr "For å støtta automatisk orddeling ved å skriva inn eit skiljeteikn i eit ord, bruk tastane CmdCtrl + minusteiknet. Ordet vert delt på denne staden når det er i slutten av linja, sjølv om automatisk orddeling for dette avsnittet er slått av." #: space_hyphen.xhp msgctxt "" "space_hyphen.xhp\n" "par_id3151245\n" "64\n" "help.text" msgid "Special characters" msgstr "Spesialteikn" #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "tit\n" "help.text" msgid "Configuring Printer and Fax Under UNIX Based Platforms" msgstr "Oppsetting av skrivar og faks på UNIX-baserte platformer" #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "bm_id3154422\n" "help.text" msgid "spadminprinters; adding, UNIXdefault printer; UNIXstandard printer under UNIXfaxes; fax programs/fax printers under UNIXprinters; faxes under UNIX" msgstr "spadminskrivarar; leggja til, UNIXstandardskrivar; UNIXstandardskrivar under UNIXfaksar; faksprogram/faksskrivarar under UNIXskrivarar; faksar under UNIX" #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "hd_id3147834\n" "1\n" "help.text" msgid "Setting up Printer and Fax Under UNIX Based Platforms" msgstr "Setja opp skrivar og faks på UNIX-baserte plattformar" #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "par_id3159876\n" "help.text" msgid "%PRODUCTNAME uses the installed fonts of your system. In a text document you can select from all printable fonts. In an HTML document or in Web layout, only fonts that are visible on screen are offered. In spreadsheets and drawings you can select from all installed fonts." msgstr "%PRODUCTNAME brukar dei installerte skrifttypane i systemet. I eit tekstdokument kan du velja mellom alle skrifttypane som kan skrivast ut. I eit HTML-dokument og i vevoppsett er berre skrifttypar som er synlege på skjermen tilgjengelege. I rekneark og teikningar kan du velja mellom alle installerte skrifttypane." #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "hd_id3148388\n" "296\n" "help.text" msgid "Changing Printer Settings" msgstr "Endra skrivarinnstillingane" #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "par_id3156284\n" "22\n" "help.text" msgid "In the Print dialog or the Printer Settings dialog, select the printer from the printers list box and click Properties. The Properties dialog appears containing several tab pages. This is where you can make settings that are used according to the PPD file of the selected printer." msgstr "Vel skrivaren i listeboksen skrivarar i dialogvindauget skriv ut eller i dialogvindauget Skrivaroppsett og trykk på Eigenskapar. Dette opnar eit dialogvindauge med mange faner der du kan velja innstillingar i høve til PPD-fila for skrivaren." #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "par_id3154270\n" "138\n" "help.text" msgid "On the Paper tab page, you can define the paper format and paper tray to be used as the default settings for this printer." msgstr "I fana Papir kan du velja papirformatet og den papirskuffa som skal brukast som standardinnstillingar for denne skrivaren." #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "par_id3145649\n" "265\n" "help.text" msgid "On the Device tab page, you can activate the special options for your printer. If your printer can only print in black and white, choose \"grayscale\" under Color, otherwise choose \"color\". If switching to grayscale leads to unfavorable results, you can also select \"color\" under Color and see how the printer or PostScript emulator applies it. Furthermore, on this tab page you can set the precision with which colors are described as well as the PostScript level." msgstr "I fana Eining kan du slå på dei spesielle innstillingane for skrivaren. Viss skrivaren din berre kan skriva ut i svart og kvit, vel du «gråtoner» under Farge, elles vel du «farve». Viss bytte til gråtoner gir uønskte resultat, kan du også velja «farge» under Farge og sjå korleis skrivaren eller PostScript-emulatoren handterer det. Dessutan kan du stilla inn kor nøyaktig fargane skal beskrivast og kva PostScript-nivå som skal brukast." #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "hd_id3147346\n" "140\n" "help.text" msgid "Selecting a Default Printer " msgstr "Velja ein standardskrivar" #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "par_id3145769\n" "31\n" "help.text" msgid "To make the printer selected from the Installed printers list box the default printer, double-click its name or click the Default button." msgstr "For å gjera den valde skrivaren i lista Installerte skrivarar til standardskrivaren, dobbeltklikkar på namnet til skrivaren eller klikkar på knappen Standard." #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "hd_id3154204\n" "141\n" "help.text" msgid "Using Fax Functionality" msgstr "Bruk av faksfunksjonar" #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "par_id3148463\n" "52\n" "help.text" msgid "If you have installed fax4CUPS on your computer you can send faxes with the $[officename] software." msgstr "Viss du har installert fax4CUPS på datamaskinen kan du senda fax med $[officename]-programmet." #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "par_id3150826\n" "304\n" "help.text" msgid "A dialog prompting you for the phone numbers to send the fax to will appear after the printout when printing to a fax4CUPS printer. Multiple numbers can be entered separated by ;" msgstr "Det vil koma opp eit dialogvindauge som spør deg om faksnummeret når du skriv til ein fax4CUPS-skrivar. Du kan skriva inn fleire nummer, skilde med ; (semikolon)." #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "par_id3154196\n" "305\n" "help.text" msgid "In $[officename] you can also activate an icon for sending faxes to a default fax. To do this, choose Tools - Customize - Toolbars, click Add Commands and add from \"Documents\" the Send Default Fax icon. You can set which fax is used when this button is pressed under %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME Writer - Print." msgstr "I $[officename] aktivera eit ikon for å senda faksar til ein standardfaks. Dette gjer du ved å velja Verktøy → Tilpass → Verktøylinjer og trykkja på knappen Legg til. I feltet Kategori merker du av for «Dokument» og leitar deg nedover i feltet Kommandoar til du finn Send standardfaks og merker denne. Trykk knappen Legg til. Du kan setja kva faks som skal brukast når du trykkjer denne knappen i %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → %PRODUCTNAME Writer → Skriv ut." #: spadmin.xhp msgctxt "" "spadmin.xhp\n" "par_id3150517\n" "84\n" "help.text" msgid "Remember to create one separate print job for each fax, otherwise, the first recipient will receive all the faxes. In the Tools - Mail Merge dialog select the Printer option and then select the Single print jobs check box." msgstr "Hugs å setja opp ein separat skrivarjobb for kvar faks. Elles vil den første mottakaren ta i mot alle faksane. Vel innstillinga Skrivar i dialogvindauget Verktøy → Vegvisar for brevfletting og kryss av for Enkle skrivarjobbar." #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "tit\n" "help.text" msgid "Changing Default Templates" msgstr "Endra standardmalane" #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "bm_id3154285\n" "help.text" msgid "modifying, see changingchanging, see also editing and replacingdefault templates; changingdefaults;documentscustom templatesupdating; templatesediting;templatestemplates;editing and savingsaving;templatesresetting;templates" msgstr "forandra, sjå endraendra, sjå også redigera og byta utstandardmalar; endrastandardar;dokumenttilpassa malaroppdatera; malarredigera;malarmalar;redigera og lagralagra;malarnullstille;malar" #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "hd_id3154285\n" "36\n" "help.text" msgid "Changing Default Templates" msgstr "Endra standardmalar" #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "par_id3152811\n" "2\n" "help.text" msgid "When you open a new document with File - New, a blank document appears based on a $[officename] template. You can edit, modify, or replace this template so that the new document contains your customized Styles or other contents." msgstr "Når du opnar eit nytt dokument med Fil → Ny vert det opna eit tomt dokument basert på ein $[officename]-mal. Du kan redigera, forandra eller byta ut denne malen, så det nye dokumentet inneheld dei tilpassa stilane dine eller anna innhald." #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "hd_id3150792\n" "3\n" "help.text" msgid "Modifying Default Templates" msgstr "Tilpassa standardmalar" #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "par_id3154365\n" "4\n" "help.text" msgid "First, open either an existing $[officename] template and modify it, or open a new document and edit it as necessary to create the desired template." msgstr "Opna anten ein eksisterande $[officename]-mal og tilpass den, eller opna eit nytt, tomt dokument og rediger det om nødvendig for å laga den ønskte malen." #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "par_id3159152\n" "6\n" "help.text" msgid "You can define a document template for each $[officename] module. The following describes how to proceed for text documents." msgstr "Du kan laga ein dokumentmal for kvar $[officename]-modul. Nedanfor vert det vist korleis du kan laga ein mal for tekstdokument." #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "par_id3145748\n" "8\n" "help.text" msgid "Save the document by choosing File - Save As Templateand saving the document in the My Templates category." msgstr "Lagra dokumentet ved å velja Fil → Malar → Lagra som mal og lagra dokumentet i kategorien Mine malar." #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "par_id3154011\n" "9\n" "help.text" msgid "Choose File - New - Templates." msgstr "Vel Fil → Ny → Malar." #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "par_id3145799\n" "11\n" "help.text" msgid "Double-click My Templates in the list. You will see the user-defined templates in the user directory specified under %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME - Paths. Select the template you have just saved." msgstr "Dobbeltklikk på Mine malar i lista. Du kan nå sjå dei tilpassa malane som er lagra i brukarmappa som er definert i %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → %PRODUCTNAME → Stiar. Vel malen du nettopp lagra." #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "par_id3146901\n" "26\n" "help.text" msgid "Choose Set as default. The next time you open a new text document, the new document will be based on the new default template." msgstr "Vel Bruk som standard. Neste gong du opnar eit nytt dokument vil dokumentet vere basert på den nye standardmalen." #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "hd_id3153764\n" "13\n" "help.text" msgid "Using Custom Templates" msgstr "Slik brukar du eigne malar" #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "par_id3150386\n" "14\n" "help.text" msgid "There are several ways to make your work easier by using your own custom templates." msgstr "Det er fleire måtar å gjera arbeidet lettare på ved å bruka eigne, sjølvdefinerte malar." #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "hd_id3149109\n" "15\n" "help.text" msgid "Templates in the Template Folder" msgstr "Malar i malmappa" #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "par_id3146918\n" "16\n" "help.text" msgid "You can save a new template with File - Save As Template or by selecting \"Template\" file type in any Save dialog. Save the template in the user directory specified under %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME - Paths to be able to access the template from within the File - New - Templates dialog." msgstr "Du kan lagra ein ny mal med File → Malar → Lagra som mal eller velja filtypen «tekstmal» i nedtrekkslista i lagringsvindauget som kjem fram når du brukar File → Lagra. Lagra malen i brukarmappa som er definert i %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → %PRODUCTNAME → Stiar slik at du har tilgang på malen frå dialogvindauget File → Ny → Malar." #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "par_id3147343\n" "17\n" "help.text" msgid "To open the template for editing, choose File - New - Templates, select the template and click the Edit button." msgstr "For å opna ein mal for redigering, vel Fil → Ny → Malar, merk malen og klikk på knappen Rediger." #: standard_template.xhp msgctxt "" "standard_template.xhp\n" "par_id3147315\n" "37\n" "help.text" msgid "Templates" msgstr "For å opna ein mal slik at du kan redigera han, vel Fil → Ny → Malar og merk malen og trykk på knappen Rediger som kjem fram øvst i vindauget. " #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "tit\n" "help.text" msgid "Starting the $[officename] Software With Parameters" msgstr "Starta $[officename] med parameterar" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "bm_id3156410\n" "help.text" msgid "start parameterscommand line parametersparameters;command linearguments in command line" msgstr "startparameterarkommandolinjeparameterarparameterar;kommandolinjeargument på kommandolinja" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "hd_id3156410\n" "52\n" "help.text" msgid "Starting the $[officename] Software With Parameters" msgstr "Starta $[officename] med parameterar" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3147009\n" "1\n" "help.text" msgid "By starting the $[officename] software from the command line you can assign various parameters, with which you can influence the performance. The use of command line parameters is only recommended for experienced users." msgstr "Ved å starta $[officename] frå kommandolinja kan bruka ulike parameterar der du kan styra utføringa av programmet. Du bør vera ein erfaren brukar for å bruka parameter på kommandolinja." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3147618\n" "2\n" "help.text" msgid "For normal handling, the use of command line parameters is not necessary. A few of the parameters require a deeper knowledge of the technical background of the $[officename] software technology." msgstr "Bruk av kommandolinjeparameterar er normalt ikkje nødvendig. Nokre få av parametera krev grundig kunnskap til den tekniske bakgrunnen for $[officename]-teknologien." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "hd_id3154898\n" "4\n" "help.text" msgid "Starting the $[officename] Software From the Command Line" msgstr "Starta $[officename] frå kommandolinja" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3156152\n" "5\n" "help.text" msgid "Under Windows, select Run from the Windows Start menu, or open a shell under Linux, *BSD, or Mac OS X platforms." msgstr "I Windows XP, vel Kjør frå startmenyen. I Windows 7 og nyare, kan du få fram Kjør mellom anna ved å halda inne Windows-logotasten og trykke R. I Linux, *BSD eller Mac OS X opnar du eit «shell»." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3152472\n" "6\n" "help.text" msgid "Under Windows, type the following text in the Open text field and click OK." msgstr "I Windows skriv du inn denne teksten i tekstfeltet Åpne og klikkar på OK." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3149669\n" "53\n" "help.text" msgid "Under UNIX-like systems, type the following line of text, then press Return:" msgstr "I UNIX-liknande system skriv du inn denne tekstlinja og trykkjer Return:" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3147561\n" "7\n" "help.text" msgid "{install}\\program\\soffice.exe {parameter} {install}/program/soffice {parameter} " msgstr "{install}\\program\\soffice.exe {parameter} {install}/program/soffice {parameter} " #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3153360\n" "8\n" "help.text" msgid "Replace {install} with the path to your installation of the $[officename] software (for example, C:\\Program Files\\Office, or ~/office)" msgstr "Byt ut {installer} med stien til installasjonen av $[officename] (for eksempel c:\\Programfiler\\Office eller ~/Office)" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3158407\n" "9\n" "help.text" msgid "Where required, replace {parameter} with one or more of the following command line parameters." msgstr "Byt ut {parameter} med eitt eller fleire av kommandolinjeparametera nedføre." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "hd_id3145171\n" "10\n" "help.text" msgid "Valid Command Line Parameters" msgstr "Gyldige kommandolinjeparameterar" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3148451\n" "11\n" "help.text" msgid "Parameter" msgstr "Parameter" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3149167\n" "12\n" "help.text" msgid "Meaning" msgstr "Tyding" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3149983\n" "73\n" "help.text" msgid "--help / -h / -?" msgstr "--help / -h / -?" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3147349\n" "74\n" "help.text" msgid "Lists the available command line parameters in a dialog boxto the console." msgstr "Lister dei tilgjengelege kommandolinjeparametera i eit dialogvindauge til konsollen." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id31499et\n" "73\n" "help.text" msgid "--version" msgstr "--version" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id31473et\n" "74\n" "help.text" msgid "Displays the version information." msgstr "Viser versjonsinformasjonen" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3150010\n" "59\n" "help.text" msgid "--writer" msgstr "--writer" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3147213\n" "60\n" "help.text" msgid "Starts with an empty Writer document." msgstr "Start med eit tomt Writer-dokument" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3148616\n" "61\n" "help.text" msgid "--calc" msgstr "--calc" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3145261\n" "62\n" "help.text" msgid "Starts with an empty Calc document." msgstr "Start med eit tomt Calc-dokument" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3156443\n" "63\n" "help.text" msgid "--draw" msgstr "--draw" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3154011\n" "64\n" "help.text" msgid "Starts with an empty Draw document." msgstr "Start med eit tomt Draw-dokument" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3153142\n" "65\n" "help.text" msgid "--impress" msgstr "--impress" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3153222\n" "66\n" "help.text" msgid "Starts with an empty Impress document." msgstr "Start med eit tomt Impress-dokument" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3155853\n" "67\n" "help.text" msgid "--math" msgstr "--math" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3146928\n" "68\n" "help.text" msgid "Starts with an empty Math document." msgstr "Start med eit tomt Math-dokument" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3149960\n" "69\n" "help.text" msgid "--global" msgstr "--global" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3151075\n" "70\n" "help.text" msgid "Starts with an empty Writer master document." msgstr "Start med eit tomt Writer-hovuddokument" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3154510\n" "71\n" "help.text" msgid "--web" msgstr "--web" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3148836\n" "72\n" "help.text" msgid "Starts with an empty HTML document." msgstr "Start med eit tomt HTML-dokument" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3149403\n" "help.text" msgid "--show {filename.odp}" msgstr "--show {filename.odp}" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3153838\n" "80\n" "help.text" msgid "Starts with the Impress file {filename.odp} and starts the presentation. Enters edit mode after the presentation." msgstr "Startar med Impress-fila {filnavn.odp} og startar presentasjonen. Går til redigeringstilstand etter presentasjonen." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3156276\n" "13\n" "help.text" msgid "--minimized" msgstr "--minimized" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3146080\n" "14\n" "help.text" msgid "Starts minimized. The splash screen is not displayed." msgstr "Startar minimert. Velkomstbiletet vert ikkje vist." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3145641\n" "15\n" "help.text" msgid "--invisible" msgstr "--invisible" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3154756\n" "16\n" "help.text" msgid "Starts in invisible mode." msgstr "Startar i usynleg tilstand." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3148914\n" "17\n" "help.text" msgid "Neither the start-up logo nor the initial program window will be visible. However, the $[officename] software can be controlled and documents and dialogs opened via the API." msgstr "Korkje oppstartsbiletet eller det opphavlege programvindauget vil vera synleg. $[officename] kan kontrollerast og dokument og dialogvindauge opnast via API." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3147341\n" "18\n" "help.text" msgid "When the $[officename] software has been started with this parameter, it can only be ended using the taskmanager (Windows) or the kill command (UNIX-like systems)." msgstr "Når $[officename] er starta med denne parameteren, kan det berra avsluttast ved hjelp av oppgåvehandteringa (Windows) eller kommandoen kill (UNIX-liknande system)." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3150388\n" "48\n" "help.text" msgid "It cannot be used in conjunction with -quickstart." msgstr "Parameteren kan ikkje brukast saman med -quickstart." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3145147\n" "19\n" "help.text" msgid "More information is found in the $[officename] Developer's Guide." msgstr "Du kan finna meir informasjon i $[officename] Developer's Guide." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3155903\n" "20\n" "help.text" msgid "--norestore" msgstr "--norestore" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3156374\n" "21\n" "help.text" msgid "Disables restart and file recovery after a system crash." msgstr "Slår av omstart og filgjenoppretting etter eit systemkrasj." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id5215918\n" "help.text" msgid "--nofirststartwizard" msgstr "--nofirststartwizard" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id5665761\n" "help.text" msgid "Disables the Welcome Wizard." msgstr "Slår av velkomstvegvisaren." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3148477\n" "25\n" "help.text" msgid "--quickstart" msgstr "--quickstart" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3153919\n" "26\n" "help.text" msgid "Activates the Quickstarter." msgstr "Slår på snøggstart." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3152479\n" "30\n" "help.text" msgid "--accept={UNO string}" msgstr "--accept={UNO string}" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3147130\n" "31\n" "help.text" msgid "Notifies the $[officename] software that upon the creation of \"UNO Acceptor Threads\", a \"UNO Accept String\" will be used." msgstr "Fortel $[officename] at det vert brukt ein «UNO Accept String» når det vert oppretta «UNO Acceptor Threads»." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3148874\n" "32\n" "help.text" msgid "More information is found in the $[officename] Developer's Guide." msgstr "Du finn meir informasjon i $[officename] Developer's Guide." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id315247a\n" "30\n" "help.text" msgid "--unaccept={UNO string}" msgstr "--unaccept={UNO string}" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id314713a\n" "31\n" "help.text" msgid "Closes an acceptor that was created with --accept={UNO string}. Use --unaccept=all to close all open acceptors." msgstr "Lukker ein «acceptor» som er laga med «--accept={UNO string}». Bruk «--unaccept=all» for å lukka alle opne «acceptor»." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3159238\n" "36\n" "help.text" msgid "-p {filename1} {filename2} ..." msgstr "-p {filnamn1} {filnamn2} …" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3163666\n" "37\n" "help.text" msgid "Prints the files {filename1} {filename2} ... to the default printer and ends. The splash screen does not appear." msgstr "Skriv ut filene {filnamn1} {filnamn2} … til standardskrivaren og avsluttar. Velkomstbiletet vert ikkje vist." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3150828\n" "49\n" "help.text" msgid "If the file name contains spaces, then it must be enclosed in quotation marks." msgstr "Viss filnamnet inneheld mellomrom, må det skrivast mellom hermeteikn." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3150883\n" "38\n" "help.text" msgid "--pt {Printername} {filename1} {filename2} ..." msgstr "--pt {Skrivarnamn} {filnamn1} {filnamn2} …" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3155081\n" "50\n" "help.text" msgid "Prints the files {filename1} {filename2} ... to the printer {Printername} and ends. The splash screen does not appear." msgstr "Skriv ut filene {filnamn1} {filnamn2} ... til skrivaren {Skrivarnamn} og avsluttar. Velkomstbiletet vert ikkje vist." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3153655\n" "51\n" "help.text" msgid "If the file name contains spaces, then it must be enclosed in quotation marks." msgstr "Viss filnamnet inneheld mellomrom, må det skrivast mellom hermeteikn. " #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3154372\n" "39\n" "help.text" msgid "-o {filename}" msgstr "-o {filnamn}" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3150309\n" "40\n" "help.text" msgid "Opens {filename} for editing, even if it is a template." msgstr "Opnar {filnamn} for redigering, sjølv om det er ein mal." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3151182\n" "54\n" "help.text" msgid "--view {filename}" msgstr "--view {filnamn}" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3145268\n" "55\n" "help.text" msgid "Creates a temporary copy of {filename} and opens it read-only." msgstr "Lagar ein mellombels kopi av {filnamn} og opnar fila som skriveverna." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3166421\n" "41\n" "help.text" msgid "-n {filename}" msgstr "-n {filnamn}" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3154259\n" "42\n" "help.text" msgid "Creates a new document using {filename} as a template." msgstr "Lagar eit nytt dokument ved bruk av {filnamn} som mal." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3155126\n" "43\n" "help.text" msgid "--nologo" msgstr "--nologo" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3151334\n" "44\n" "help.text" msgid "Disables the splash screen at program start." msgstr "Slår av velkomstbiletet ved programstart." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3159171\n" "75\n" "help.text" msgid "--nodefault" msgstr "--nodefault" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3153306\n" "76\n" "help.text" msgid "Starts without displaying anything except the splash screen." msgstr "Startar utan å visa anna enn velkomstbiletet." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id315917t\n" "75\n" "help.text" msgid "--nolockcheck" msgstr "--nolockcheck" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id315330t\n" "76\n" "help.text" msgid "Disables check for remote instances using the installation." msgstr "Slår av kontrollen for eksterne einingar som brukar installasjonen." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id2211676\n" "help.text" msgid "--nofirststartwizard" msgstr "--nofirststartwizard" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id1641895\n" "help.text" msgid "Add this parameter to the program start command to suppress the Welcome Wizard." msgstr "Legg denne parameteren til programstartkommandoen for å undertrykkja velkomstvegvisaren." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3153915\n" "45\n" "help.text" msgid "--display {display}" msgstr "--display {display}" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3146786\n" "46\n" "help.text" msgid "Sets the DISPLAY environment variable on UNIX-like platforms to the value {display}. This parameter is only supported by the start script for the $[officename] software on UNIX-like platforms." msgstr "Set variablen DISPLAY på UNIX-liknande plattformer til verdien {display}. Denne parameteren har støtte berre frå startskriptet for $[officename]-programmet på UNIX-liknande plattformer." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3149595\n" "56\n" "help.text" msgid "--headless" msgstr "--headless" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3150530\n" "57\n" "help.text" msgid "Starts in \"headless mode\" which allows using the application without user interface." msgstr "Startar i «headless mode» som tillet bruk av programmet utan brukargrensesnitt." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id3156353\n" "58\n" "help.text" msgid "This special mode can be used when the application is controlled by external clients via the API." msgstr "Denne spesialtilstanden kan brukast når programmet er kontrollert av eksterne klientar via API-et." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id314959o\n" "56\n" "help.text" msgid "--infilter={filter}" msgstr "--infilter={filter}" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id315053o\n" "57\n" "help.text" msgid "Forces an input filter type, if possible. Eg. --infilter=\"Calc Office Open XML\"." msgstr "Tvingar, om mogleg, ein filtertype for inndata. F. eks. --infilter=\"Calc Office Open XML\"." #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id314959p\n" "56\n" "help.text" msgid "--convert-to output_file_extension[:output_filter_name] [--outdir output_dir] files" msgstr "--convert-to output_file_extension[:output_filter_namn] [--outdir output_dir] filer" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id315053p\n" "57\n" "help.text" msgid "Batch convert files. If --outdir is not specified, then current working directory is used as output_dir.
Eg. --convert-to pdf *.doc
--convert-to pdf:writer_pdf_Export --outdir /home/user *.doc" msgstr "Konverter filer satsvis. Viss --outdir ikkje er oppgjeve, vert den gjeldande arbeidsmappa brukt som output_dir.
For eksempel --convert-to pdf *.doc
--convert-to pdf:writer_pdf_Export --outdir /home/user *.doc" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id314959q\n" "56\n" "help.text" msgid "--print-to-file [--printer-name printer_name] [--outdir output_dir] files" msgstr "--print-to-file [--printer-name printer_name] [--outdir output_dir] files" #: start_parameters.xhp msgctxt "" "start_parameters.xhp\n" "par_id315053q\n" "57\n" "help.text" msgid "Batch print files to file. If --outdir is not specified, then current working directory is used as output_dir.
Eg. --print-to-file *.doc
--print-to-file --printer-name nasty_lowres_printer --outdir /home/user *.doc" msgstr "Satsvis skriving av fil til fil. Viss --outdir ikkje er oppgjeve, vert den gjeldande arbidsmappa brukt som output_dir.
For eksempel --print-to-file *.doc
--print-to-file --printer-name nasty_lowres_printer --outdir /home/user *.doc" #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "tit\n" "help.text" msgid "Start Center" msgstr "Startside" #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "bm_id0820200802500562\n" "help.text" msgid "backing window start center" msgstr "startsidestartsenter" #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "hd_id0820200802524447\n" "help.text" msgid "Start Center" msgstr "Startside" #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id0820200803204063\n" "help.text" msgid "Welcome to %PRODUCTNAME.Thank you for using the %PRODUCTNAME application help.Press F1 whenever you need help using the %PRODUCTNAME software." msgstr "Velkommen til %PRODUCTNAME. Takk for at du valde %PRODUCTNAME programhjelp. Trykk F1 når du treng hjelp om bruken av %PRODUCTNAME-programmet." #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id0820200802524413\n" "help.text" msgid "You see the Start Center when no document is open in %PRODUCTNAME. It is divided into two panes. Click an icon on the left pane to open a new document or a file dialog." msgstr "Når ingen dokument er opna i %PRODUCTNAME vert startsenteret vist. Dette er delt opp i to panel. Klikk på eitt av symbola på det venstre panelet for å opna eit nytt dokument eller eit dialogvindauge for å opna filer." #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id0820200803104810\n" "help.text" msgid "The document icons each open a new document of the specified type." msgstr "Kvart av dokumentsymbola opnar eit nytt dokument av den typen symbolet representerer." #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id0820200803104978\n" "help.text" msgid "Text Document opens %PRODUCTNAME Writer" msgstr "Tekstdokument opnar %PRODUCTNAME Writer" #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id0820200803104998\n" "help.text" msgid "Spreadsheet opens %PRODUCTNAME Calc" msgstr "Rekneark startar %PRODUCTNAME Calc" #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id0820200803104927\n" "help.text" msgid "Presentation opens %PRODUCTNAME Impress" msgstr "Presentasjon startar %PRODUCTNAME Impress" #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id0820200803104948\n" "help.text" msgid "Drawing opens %PRODUCTNAME Draw" msgstr "Teikning startar %PRODUCTNAME Draw" #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id0820200803105089\n" "help.text" msgid "Database opens %PRODUCTNAME Base" msgstr "Database startar %PRODUCTNAME Base" #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id0820200803105015\n" "help.text" msgid "Formula opens %PRODUCTNAME Math" msgstr "Formel startar %PRODUCTNAME Math" #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id1022200911011855\n" "help.text" msgid "The Templates icon opens the Templates and Documents dialog." msgstr "Knappen «Malar» opnar dialogvindauget «Malar og dokument»." #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id0820200803105045\n" "help.text" msgid "The Templates icon opens the Templates and Documents dialog." msgstr "Knappen Malar opnar dialogvindauget Malar og dokument." #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id1022200911011975\n" "help.text" msgid "The Open a Document icon presents a file open dialog." msgstr "Knappen «Opna» opnar dialogvindauget «Opna»." #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id082020080310500\n" "help.text" msgid "The Open a document icon presents a file open dialog." msgstr "Knappen Opna eit dokument opnar dialogvindauget Opna." #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id0820200802525413\n" "help.text" msgid "The right pane contains thumbnails of the most recent documents you opened. Hover your mouse over the thumbnail to highlight the document, display a tip about the document location and display an icon on the top right to delete the thumbnail from the pane and from the recent files list. Click on the thumbnail to open the document underneath." msgstr "Det høgre panelet inneheld miniatyrar av dei sist brukte dokumenta. Hald musepeikaren over miniatyren for å utheva dokumentet og få fram eit tips om kvar dokumentet er lagra og for å visa eit ikon oppe til venstre som du kan trykka på for å fjerna dokumentet frå visinga og fillista. Klikk på sjølve miniatyren for å opna dokumentet han viser til." #: startcenter.xhp msgctxt "" "startcenter.xhp\n" "par_id0820200802626413\n" "help.text" msgid "Not every file type will display a thumbnail image of its content. Instead, you may see a large icon used by your computer for that filetype." msgstr "Ikkje alle filtypane vil visa ein miniatyr med innhaldet. I staden vert det vist eit stort ikon. Utsjånaden på ikonet vert bestemt av filtypen og datamaskinen. " #: tabs.xhp msgctxt "" "tabs.xhp\n" "tit\n" "help.text" msgid "Inserting and Editing Tab Stops" msgstr "Setja inn og redigera tabulatorar" #: tabs.xhp msgctxt "" "tabs.xhp\n" "bm_id3144436\n" "help.text" msgid "tab stops; inserting and editingparagraphs; tab stopsdefaults;tab stops in textediting; tab stopsinserting;tab stopsdecimal tab stopsdeleting;tab stopsmoving;tab stops on rulerrulers; default settingsrulers; measurement unitsmeasurement units; changing on rulers" msgstr "tabulatorar; setja inn og redigeraavsnitt; tabulatorarstandardar;tabulatorar i tekstredigera; tabulatorarsetja inn;tabulatorardesimaltabulatorarsletta;tabulatorarflytta;tabulatorar på linjallinjalar; standard innstillingarlinjalar; måleeiningarmåleeiningar; forandra på linjalar" #: tabs.xhp msgctxt "" "tabs.xhp\n" "hd_id3144436\n" "20\n" "help.text" msgid "Inserting and Editing Tab Stops" msgstr "Setja inn og redigera tabulatorar" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id1376079\n" "help.text" msgid "On the horizontal ruler you can see the tab stops for the current paragraph. If you want to change the tab stops, you should first consider the scope to which you want to change tab stops as follows:" msgstr "Tabulatorane for det gjeldande avsnittet vert viste på den vassrette linjalen. Viss du vil endra tabulatorane, bør du først vurdera omfanget av endringane:" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id9434492\n" "help.text" msgid "Change the default tab stops for all documents: Use the menu %PRODUCTNAME - PreferencesTools - Options - %PRODUCTNAME Writer - General." msgstr "Endra standardtabulatorane for alle dokumenta: Bruk menyen %PRODUCTNAME → InnstilingarVerktøy → Innstillingar → %PRODUCTNAME Writer → Generelt." #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id274971\n" "help.text" msgid "Change the tab stops for all paragraphs using the current Paragraph Style: Right-click the paragraph to open the context menu, choose Edit Paragraph Style, click Tabs." msgstr "Endra tabulatorar for alle avsnitt som brukar den gjeldande avsnittsstilen: Høgreklikk på avsnittet for å opna sprettoppmenyen, vel Rediger avsnittsstil og klikk på Tabulatorar." #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id5199133\n" "help.text" msgid "Change the tab stops for one or more paragraphs: Select the paragraphs, then click inside the ruler." msgstr "Endra tabulatorar for eit eller fleire avsnitt: Merk avsnitta og klikk innføre linjalane." #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id6178167\n" "help.text" msgid "In the following, you find instructions for all above mentioned tasks." msgstr "I det følgjande finn du instruksjonar for alle omtalte oppgåver." #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3147008\n" "27\n" "help.text" msgid "You can set a tab stop by clicking on the ruler or by selecting Format - Paragraph - Tabs. Both methods affect the current paragraph or all selected paragraphs." msgstr "Du kan setja ein tabulator ved å klikka på linjalen eller ved å velja Format → Avsnitt → Tabulatorar. Metodane påverkar det aktuelle avsnittet eller alle merkte avsnitt." #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3155136\n" "5\n" "help.text" msgid "Click the ruler once to set a left-justified tab. Right-click a tab icon on the ruler to see the context menu in which you can change the tab type." msgstr "Klikk ei gong på linjalen for å setja ein venstrejustert tabulator. Høgreklikk på eit tabulatormerke på linjalen for å få opp sprettoppmenyen for å endra tabulatortype." #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3153561\n" "29\n" "help.text" msgid "To set several decimal tabs one after the other, keep clicking the icon to the left of the ruler until the desired tab type is shown, then click on the ruler." msgstr "For at setja fleire desimaltabulatorar etter kvarandre, hald fram med å klikka på symbolet til venstre for linjalen til den ønskte tabulatortypen kjem fram, og klikk så på linjalen." #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3153349\n" "18\n" "help.text" msgid "Selection" msgstr "Utval" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3153254\n" "6\n" "help.text" msgid "Description:" msgstr "Skildring" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3151245\n" "help.text" msgid "Icon" msgstr "Ikon" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3154760\n" "7\n" "help.text" msgid "Setting left tabs" msgstr "Setja venstre tabulatorar" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3150358\n" "help.text" msgid "Icon" msgstr "Ikon" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3145419\n" "8\n" "help.text" msgid "Setting right tabs" msgstr "Setja høgre tabulatorar" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3152933\n" "help.text" msgid "Icon" msgstr "Ikon" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3151043\n" "9\n" "help.text" msgid "Setting decimal tabs" msgstr "Setja inn desimaltabulatorar" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3150440\n" "help.text" msgid "Icon" msgstr "Ikon" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3153091\n" "10\n" "help.text" msgid "Setting centered tabs" msgstr "Setja inn sentrerte tabulatorar" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3154150\n" "11\n" "help.text" msgid "Double-click the ruler to open the Paragraph dialog." msgstr "Dobbeltklikk på linjalen for å opna dialogvindauget Avsnitt." #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3154145\n" "12\n" "help.text" msgid "Double-click the white area of the ruler to set one tab. The Paragraph dialog appears with the Tabs tab page open." msgstr "Dobbeltklikk i det kvite området av linjalen for å stilla inn ein tabulator. Dialogvindauget Avsnitt kjem fram med fana Tabulatorar opna." #: tabs.xhp msgctxt "" "tabs.xhp\n" "hd_id3145748\n" "21\n" "help.text" msgid "Moving Tabs on the Ruler" msgstr "Flytta tabulatorar på linjalen" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3145264\n" "22\n" "help.text" msgid "Move individual tab stops on the ruler using the mouse." msgstr "Flytte individuelle tabulatorar på linjalen ved bruk av musa." #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3159156\n" "13\n" "help.text" msgid "To move several tab stops on the ruler, press the Shift key before you click a tab. Drag one tab while continuing to press Shift to move that tab as well as all the tabs to the right of it. The spacing between those tabs remains the same." msgstr "For å flytta fleire tabulatorar på linjalen, trykk på Shift før du klikkar på ein tabulator. Dra ein tabulator medan du held nede Shift-tasten heile tida for å flytta tabulatoren og alle tabulatorane til høgre for han. Avstanden mellom desse tabulatorane vert uendra." #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3147349\n" "23\n" "help.text" msgid "Press Command Ctrl when you drag a tab on the ruler to move that tab and all the tabs to the right of it. This results in the spacing between those tabs changing proportionally to their distance from the margin." msgstr "Hald nede Cmd Ctrl når du drar ein tabulator på linjalen for å flytta tabulatoren og alle til høgre for han. Dette gjer at mellomromma mellom desse vert forandra i høve til avstanden frå margen." #: tabs.xhp msgctxt "" "tabs.xhp\n" "hd_id3146146\n" "24\n" "help.text" msgid "Changing the Properties of Tabs" msgstr "Endring av tabulatoreigenskapane" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3145646\n" "16\n" "help.text" msgid "To change tab type, click the tab you want to change on the ruler, then right-click to open the context menu." msgstr "For å endra tabulatortype, klikk på linjalen på tabulatoren som du vil endra og høgreklikk for å opna sprettoppmenyen." #: tabs.xhp msgctxt "" "tabs.xhp\n" "hd_id3154729\n" "25\n" "help.text" msgid "Deleting Tabs" msgstr "Sletta tabulatorar" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3148879\n" "17\n" "help.text" msgid "To delete a tab, hold down the mouse button while you drag the tab outside the ruler." msgstr "For å sletta ein tabulator, hald nede museknappen medan du drar tabulatoren utanfor linjalen." #: tabs.xhp msgctxt "" "tabs.xhp\n" "hd_id3151074\n" "26\n" "help.text" msgid "Changing the Defaults" msgstr "Endra standardar" #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3151059\n" "14\n" "help.text" msgid "If you want to change the settings of your default tab stops, you will find further information under %PRODUCTNAME Writer - General%PRODUCTNAME Calc - General%PRODUCTNAME Draw - General%PRODUCTNAME Impress - General(module name) - General in the Options dialog box." msgstr "Viss du ønskjer å endra standardinnstillingane for tabulatorane kan du finne meir informasjon om dette i %PRODUCTNAME Writer → Generelt%PRODUCTNAME Calc → Generelt%PRODUCTNAME Draw → Generelt%PRODUCTNAME Impress → Generelt(module name) - General i dialogvindauget for innstillingar." #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3146972\n" "15\n" "help.text" msgid "The context menu of the ruler allows you to change the displayed units of measurement. These changes are only valid until you exit $[officename], and they only apply to the ruler on whose context menu you made the change. If you want to change the ruler measurement units permanently, choose Tools - Options - [Document type] - View and change the measurement unit there." msgstr "Sprettoppmenyen på linjalen gir deg høve til å byta måleeiningar. Desse endringane er berre gyldige til du avsluttar $[officename] og gjeld berre i sprettoppmenyen for linjalen du laga endringane i. Viss du vil endra måleeiningane i linjalen permanent, vel Verktøy → Innstillingar → [Dokumenttype] → Vis og endra måleeiningane der." #: tabs.xhp msgctxt "" "tabs.xhp\n" "par_id3148429\n" "30\n" "help.text" msgid "Ruler" msgstr "Linjal" #: text_color.xhp msgctxt "" "text_color.xhp\n" "tit\n" "help.text" msgid "Changing the Color of Text" msgstr "Endra tekstfargen" #: text_color.xhp msgctxt "" "text_color.xhp\n" "bm_id3156014\n" "help.text" msgid "text; coloring characters; coloring colors; fonts fonts;colors" msgstr "tekst; farga teikn; farga fargar; skrifttypar skrifttypar;fargar" #: text_color.xhp msgctxt "" "text_color.xhp\n" "hd_id3156014\n" "42\n" "help.text" msgid "Changing the Color of Text" msgstr "Endra tekstfargen" #: text_color.xhp msgctxt "" "text_color.xhp\n" "par_id3150040\n" "40\n" "help.text" msgid "Click the arrow next to the Font Color icon to activate a toolbar from which you can choose from a range of colors." msgstr "Klikk på pila ved sida av knappen Skriftfarge for å slå på ei verktøylinje der du kan velja ein farge." #: text_color.xhp msgctxt "" "text_color.xhp\n" "par_id3156410\n" "help.text" msgid "Icon" msgstr "Ikon" #: text_color.xhp msgctxt "" "text_color.xhp\n" "par_id3152781\n" "45\n" "help.text" msgid "Font Color" msgstr "Skriftfarge" #: text_color.xhp msgctxt "" "text_color.xhp\n" "par_id3154897\n" "help.text" msgid "Icon" msgstr "Ikon" #: text_color.xhp msgctxt "" "text_color.xhp\n" "bm_id3149795\n" "help.text" msgid "paint can symbol" msgstr "målespann-symbol" #: text_color.xhp msgctxt "" "text_color.xhp\n" "par_id3149795\n" "41\n" "help.text" msgid "The following only applies to %PRODUCTNAME Writer: If you click the icon with a short-click while no text is selected, then the mouse pointer changes its appearance and is displayed as a paint can. Use this paint can symbol with the mouse key pressed to drag across a text area. This text area takes the selected color. The function remains active for as long as the icon is pressed, or until you click without dragging, or until you press the Escape key." msgstr "Det følgjande gjeld berre for %PRODUCTNAME Writer: Viss du klikkar på knappen med eit kort klikk og ingen tekst er merkt, vert utsjånaden til musepeikaren endra til eit målingspann. Hald nede museknappen og bruk dette målingspannet for å dra på tvers av eit tekstområde. Dette tekstområdet får den valde fargen. Funksjonen er slått på så lenge knappen er nede eller til du klikkar utan å dra eller til du trykkjer på Escape." #: text_color.xhp msgctxt "" "text_color.xhp\n" "par_id3145120\n" "46\n" "help.text" msgid "The following applies to all modules (%PRODUCTNAME Writer, Calc, Draw, Impress): Select the text that is to take another color, then click the color you want on the toolbar." msgstr "Dette gjeld for alle program (%PRODUCTNAME Writer, Calc, Draw, Impress): Merk teksten som skal ha ein annan farge og klikk på verktøylinja på fargen du ønskjer." #: text_color.xhp msgctxt "" "text_color.xhp\n" "par_id3154285\n" "43\n" "help.text" msgid "Font color" msgstr "Skriftfarge" #: textmode_change.xhp msgctxt "" "textmode_change.xhp\n" "tit\n" "help.text" msgid "Switching Between Insert Mode and Overwrite Mode" msgstr "Byte mellom innsettingstilstand og overskrivingstilstand" #: textmode_change.xhp msgctxt "" "textmode_change.xhp\n" "bm_id3159233\n" "help.text" msgid "text; overwriting or insertingoverwrite modeinsert mode for entering text" msgstr "tekst; skriva over eller setja innoverskrivingsmodusinnsetjingsmodus for å skriva inn tekst" #: textmode_change.xhp msgctxt "" "textmode_change.xhp\n" "hd_id3159233\n" "1\n" "help.text" msgid "Switching Between Insert Mode and Overwrite Mode" msgstr "Byte mellom innsettingstilstand og overskrivingstilstand" #: textmode_change.xhp msgctxt "" "textmode_change.xhp\n" "hd_id3149811\n" "2\n" "help.text" msgid "With the keyboard:" msgstr "Med tastaturet:" #: textmode_change.xhp msgctxt "" "textmode_change.xhp\n" "par_id3153031\n" "3\n" "help.text" msgid "Press Insert to toggle between overwrite mode and insert mode. The current mode is displayed on the Status Bar. The text cursor must be enabled in the cell or in the input line. " msgstr "Trykk tasten «Insert» for å byta mellom overskrivingsmodus og innsettingsmodus. Den gjeldande modusen vert vist på statuslinja. Markøren må vera slått på i cella eller på inndatalinja. " #: textmode_change.xhp msgctxt "" "textmode_change.xhp\n" "hd_id3152349\n" "4\n" "help.text" msgid "With the mouse:" msgstr "Med musa:" #: textmode_change.xhp msgctxt "" "textmode_change.xhp\n" "par_id3159157\n" "5\n" "help.text" msgid "On the Status Bar, click on the area indicating the current mode in order to switch to the other mode:" msgstr "Klikk på statuslinja på området som viser den aktuelle tilstanden for å byta til ein annan tilstand:" #: textmode_change.xhp msgctxt "" "textmode_change.xhp\n" "par_id3145673\n" "6\n" "help.text" msgid "INSRT" msgstr "INN" #: textmode_change.xhp msgctxt "" "textmode_change.xhp\n" "par_id3154307\n" "7\n" "help.text" msgid "Insert mode is enabled. The text cursor is a blinking vertical line. Click on the area to enable the overwrite mode." msgstr "Innsettingsmodus er slått på.Skrivemerket er ei blinkande loddrett linje.Klikk på området for å slå på overskrivningsmodusen." #: textmode_change.xhp msgctxt "" "textmode_change.xhp\n" "par_id3150984\n" "8\n" "help.text" msgid "OVER" msgstr "OVER" #: textmode_change.xhp msgctxt "" "textmode_change.xhp\n" "par_id3148491\n" "9\n" "help.text" msgid "The overwrite mode is enabled. The text cursor is a blinking block. Click on the area to enable insert mode." msgstr "Overskrivningsmodusen er slått på.Skrivemerket er ei blinkande blokk.Klikk på området for å slå på innsettingsmodus." #: textmode_change.xhp msgctxt "" "textmode_change.xhp\n" "par_id3154346\n" "10\n" "help.text" msgid "Keyboard commands" msgstr "Tastaturkommandoar" #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "tit\n" "help.text" msgid "Undoing Direct Formatting for a Document" msgstr "Angra direkte formatering i eit dokument" #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "bm_id6606036\n" "help.text" msgid "undoing;direct formattingdirect formatting;undoing alldeleting;all direct formattingtext attributes;undoingformatting;undoingrestoring;default formatting" msgstr "angra;direkte formateringdirekte formatering;angra altsletta;all direkte formateringtekstattributt;angraformatering;angragjenoppretta;standard formatering" #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_idN1067F\n" "help.text" msgid "Undoing Direct Formatting for a Document" msgstr "Angra direkte formatering i eit dokument" #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_idN10683\n" "help.text" msgid "You can undo all formatting that has not been made by styles in a few steps." msgstr "Du kan angra alle formateringar som ikkje er laga med stilar ved hjelp av nokre enkle steg." #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_idN10639\n" "help.text" msgid "Removing all Direct Formatting in a $[officename] Writer Document" msgstr "Fjerna all direkte formatering i eit $[officename] Writer-dokument." #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_idN1063F\n" "help.text" msgid "Press Ctrl+A to select the whole text." msgstr "Trykk Ctrl + A for å merkja heile teksten." #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_idN10643\n" "help.text" msgid "Choose Format - Clear Direct Formatting." msgstr "Vis Format → Standardformatering." #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_idN1064A\n" "help.text" msgid "Removing all Direct Formatting in a $[officename] Calc Spreadsheet" msgstr "Fjerna all direkte formatering i eit $[officename] Calc-rekneark" #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_idN10650\n" "help.text" msgid "While pressing the Shift key click the first and then the last sheet tab to select all sheets." msgstr "Du merkje alle arka ved å halda nede Shift medan du trykkjer på den første og den siste arkfanen." #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_idN106DD\n" "help.text" msgid "Press Ctrl+A to select the whole text." msgstr "Trykk Ctrl + A for å merkja heile teksten." #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_idN106F0\n" "help.text" msgid "Choose Format - Clear Direct Formatting." msgstr "Vis Format → Standardformatering." #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_idN1065F\n" "help.text" msgid "Removing all Direct Formatting in a $[officename] Presentation" msgstr "Fjern all direkte formatering i ein $[officename] presentasjon" #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_idN10665\n" "help.text" msgid "Click the Outline tab to open outline view." msgstr "Klikk på fana Disposisjon for å opna disposisjonsvisinga." #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_id3906674\n" "help.text" msgid "Press Ctrl+A to select the whole text." msgstr "Trykk Ctrl + A for å merkja heile teksten." #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_idN1075E\n" "help.text" msgid "Choose Format - Clear Direct Formatting." msgstr "Vis Format → Standardformatering." #: undo_formatting.xhp msgctxt "" "undo_formatting.xhp\n" "par_idN107B0\n" "help.text" msgid "Undo Options" msgstr "Innstillingar for Angre" #: version_number.xhp msgctxt "" "version_number.xhp\n" "tit\n" "help.text" msgid "Versions and Build Numbers" msgstr "Versjonar og utgjevingsnummer" #: version_number.xhp msgctxt "" "version_number.xhp\n" "bm_id3144436\n" "help.text" msgid "versions; $[officename]build numbers of $[officename]copyright for $[officename]" msgstr "versjonar; $[officename]byggenummer til $[officename]opphavsrett for $[officename]" #: version_number.xhp msgctxt "" "version_number.xhp\n" "hd_id3144436\n" "4\n" "help.text" msgid "Versions and Build Numbers" msgstr "Versjonar og utgjevingsnummer" #: version_number.xhp msgctxt "" "version_number.xhp\n" "par_id3149346\n" "5\n" "help.text" msgid "Choose Help - About $[officename]. This opens a dialog containing information about the program." msgstr "Vel Hjelp → Om $[officename]. Dette opnar eit dialogvindauge med informasjon om programmet." #: version_number.xhp msgctxt "" "version_number.xhp\n" "par_id3147008\n" "3\n" "help.text" msgid "See lists of code and Wiki contributors on the LibreOffice website." msgstr "Sjå ei liste over kode og Wiki-bidragsytarar på LibreOffice si nettside." #: viewing_file_properties.xhp msgctxt "" "viewing_file_properties.xhp\n" "tit\n" "help.text" msgid "Viewing File Properties" msgstr "Visa fileigenskapar" #: viewing_file_properties.xhp msgctxt "" "viewing_file_properties.xhp\n" "bm_id3152594\n" "help.text" msgid "properties;filesfiles;propertiesviewing;file properties" msgstr "hyperlenkjer; setja innlenkjer; setja innsetja inn; hyperlenkjer" #: viewing_file_properties.xhp msgctxt "" "viewing_file_properties.xhp\n" "hd_id3152594\n" "9\n" "help.text" msgid "Viewing File Properties" msgstr "Visa fileigenskapar" #: viewing_file_properties.xhp msgctxt "" "viewing_file_properties.xhp\n" "par_id3147399\n" "1\n" "help.text" msgid "File properties, such as author name, subject, and keywords, help you manage and identify your documents. $[officename] also tracks file statistics, including the number of words and the number of pages in a document, and automatically adds the statistics as part of the file property." msgstr "Filegienskapar, som forfattarnamn, emne og nøkkelord, hjelper deg med å administrera og identifisera dokumenta dine. $[officename] lagar også filstatistikk, inkludert talet på ord og talet på sider i eit dokument og legg automatisk til statistikken som ein del av fileigenskapane." #: viewing_file_properties.xhp msgctxt "" "viewing_file_properties.xhp\n" "par_id3147834\n" "2\n" "help.text" msgid "You can view file properties for the current document or for a document in the Windows File Open dialog ." msgstr "Du kan sjå fileigenskapane for det gjeldande dokumentet eller for eit dokument i filopningsdialogvindauget i Windows." #: viewing_file_properties.xhp msgctxt "" "viewing_file_properties.xhp\n" "hd_id3159233\n" "3\n" "help.text" msgid "To view file properties for the current document:" msgstr "Slik kan du sjå fileigenskapane i det gjeldande dokumentet:" #: viewing_file_properties.xhp msgctxt "" "viewing_file_properties.xhp\n" "par_id3153311\n" "4\n" "help.text" msgid "Choose File - Properties." msgstr "Vis Fil → Eigenskapar." #: viewing_file_properties.xhp msgctxt "" "viewing_file_properties.xhp\n" "hd_id3150443\n" "5\n" "help.text" msgid "To view file properties for a document listed in the Windows File Open dialog" msgstr "Slik kan du sjå fileigenskapane eit dokument i filopningsdialogvindauget i Windows" #: viewing_file_properties.xhp msgctxt "" "viewing_file_properties.xhp\n" "par_id3166460\n" "6\n" "help.text" msgid "Choose File - Open." msgstr "Vis Fil → Opna." #: viewing_file_properties.xhp msgctxt "" "viewing_file_properties.xhp\n" "par_id3154306\n" "7\n" "help.text" msgid "Select a file in the list." msgstr "Merk ei fil i lista." #: viewing_file_properties.xhp msgctxt "" "viewing_file_properties.xhp\n" "par_id3145121\n" "8\n" "help.text" msgid "Right-click and choose Properties." msgstr "Høgreklikk og vel Eigenskapar." #: workfolder.xhp msgctxt "" "workfolder.xhp\n" "tit\n" "help.text" msgid "Changing Your Working Directory" msgstr "Byta arbeidsmappe" #: workfolder.xhp msgctxt "" "workfolder.xhp\n" "bm_id3150789\n" "help.text" msgid "working directory change My Documents folder;changing work directory paths; changing work directory pictures; changing paths changing;work directory" msgstr "byta arbeidsmappeMappa Mine dokument;byta arbeidsmappestiar; byta arbeidsmappebilete; byta stiarbyta;arbeidsmappe" #: workfolder.xhp msgctxt "" "workfolder.xhp\n" "hd_id3149346\n" "2\n" "help.text" msgid "Changing Your Working Directory" msgstr "Byta arbeidsmappe" #: workfolder.xhp msgctxt "" "workfolder.xhp\n" "par_id3150774\n" "3\n" "help.text" msgid "When you start a dialog to open or save a document, $[officename] initially displays your working directory. To change this directory:" msgstr "Når du opnar eit dialogvindauge for å opna eller lagra eit dokument, viser $[officename] først arbeidsmappa. Slik byter du til ei anna mappe:" #: workfolder.xhp msgctxt "" "workfolder.xhp\n" "par_id3153681\n" "4\n" "help.text" msgid "Choose %PRODUCTNAME - PreferencesTools - Options - $[officename] - Paths." msgstr "Vis Verktøy → Innstillingar → $[officename]." #: workfolder.xhp msgctxt "" "workfolder.xhp\n" "par_id3163802\n" "5\n" "help.text" msgid "Click My Documents and click the Edit button, or double-click on My Documents." msgstr "Klikk på Mine dokument og klikk på knappen Rediger eller dobbeltklikk på Mine dokument." #: workfolder.xhp msgctxt "" "workfolder.xhp\n" "par_id3153880\n" "6\n" "help.text" msgid "In the Select Path dialog, choose the working directory you want and click Select." msgstr "I dialogvindauget Vel sti vel du arbeidsmappa du vil bruka og trykkjer Vel." #: workfolder.xhp msgctxt "" "workfolder.xhp\n" "par_id3158430\n" "7\n" "help.text" msgid "You also use this procedure to change the directory displayed by $[officename] when you want to insert a graphic. Choose %PRODUCTNAME - PreferencesTools - Options - $[officename] - Paths - Images, then follow step 3." msgstr "Du kan også bruka denne metoden for å endra mappa som $[officename] viser når du skal setja inn eit bilete. Vel %PRODUCTNAME → InnstillingarVerktøy → Innstillingar → $[officename] → Stiar → Bilete og følj steg 3." #: workfolder.xhp msgctxt "" "workfolder.xhp\n" "par_id3154286\n" "8\n" "help.text" msgid "Paths" msgstr "Stiar" #: xforms.xhp msgctxt "" "xforms.xhp\n" "tit\n" "help.text" msgid "XML Form Documents (XForms)" msgstr "XML-skjemadokument (XForms)" #: xforms.xhp msgctxt "" "xforms.xhp\n" "bm_id5215613\n" "help.text" msgid "web documents;XFormsforms;XFormsXML Forms, see XFormsXForms;opening/editingediting;XFormsopening;XForms" msgstr "nettside-dokument;XFormsskjema;XFormsXML-skjema, sjå XFormsXForms;opna/redigeraredigera;XFormsopna;XForms" #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN106E5\n" "help.text" msgid "XML Form Documents (XForms)" msgstr "XML-skjemadokument (XForms)" #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN106F5\n" "help.text" msgid "XForms are a new type of web form that was developed by the World Wide Web Consortium. The XForm model is defined in Extensible Markup Language (XML). The model uses separate sections to describe what a form does and what a form looks like. You can view the specification for XForms at: http://www.w3.org/MarkUp/Forms/." msgstr "XForms er ein ny type vevskjema som er utvikla av World Wide Web Consortium. XForm-modellen er definert i Extensible Markup Lanuage (XML). Modellen brukar separate delar for å beskriva kva eit skjema gjer og korleis det ser ut. Du kan sjå spesifikasjonen for XForms på: http://www.w3.org/MarkUp/Forms/." #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN10746\n" "help.text" msgid "Working with XForms" msgstr "Arbeida med XForms" #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN1074A\n" "help.text" msgid "In %PRODUCTNAME, an XForms document is a special type of Writer document. The Design Mode for an XForm document has additional toolbars and panes." msgstr "I %PRODUCTNAME er eit XForms-dokument ein spesiell type Writer-dokument. Utformingsmodus for eit XForm-dokument har ekstra verktøylinjer og felt." #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN1074D\n" "help.text" msgid "After you create and save an XForms document, you can open the document, fill out the form, and submit the changes to a server." msgstr "Når du har laga og lagra eit XForms-dokument, kan du opna dokumentet, fylle ut skjemaet, og senda inn endringane til ein tenar." #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN10706\n" "help.text" msgid "To Create a New XForms Document" msgstr "Laga eit nytt XForms-dokument" #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN1070D\n" "help.text" msgid "Choose File - New - XML Form Document." msgstr "Vel Fil → Ny → XML-skjemadokument." #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN10714\n" "help.text" msgid "The XForms design window opens in an empty Writer document." msgstr "XForms-utformingsvindauget vert opna i eit tomt Writer-dokument." #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN10718\n" "help.text" msgid "Design your form." msgstr "Utform skjemaet ditt." #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN1071E\n" "help.text" msgid "Insert a control, select the default model in the property browser, and enter a binding statement." msgstr "Set inn eit kontrollelement, vel standardmodellen i eigenskapar og skriv inn eit bindingsuttrykk." #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN10722\n" "help.text" msgid "In the data navigator, add an element to the instance." msgstr "Legg til eit element i for eksempel datastrukturen." #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN10726\n" "help.text" msgid "Load a new instance from an XML file and add controls to the relevant XML elements or attributes." msgstr "Last inn ei ny førekomst frå ei XML-fil og legg inn kontrollelement til dei relevante XML-elementa eller attributta." #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN10729\n" "help.text" msgid "To Open an XForms Document" msgstr "Slik opnar du eit XForms-dokument" #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN10730\n" "help.text" msgid "Choose File - Open and select the XForms document. An XForm document has the same extension as a Writer text document (*.odt)." msgstr "Vel Fil → Opna og vel XForms-dokumentet. Eit XForms-dokument har det same filetternamnet som eit Writer-tekstdokument (*.odt)." #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN10737\n" "help.text" msgid "To Edit an XForms Document" msgstr "Slik redigerer du eit XForms-dokument" #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN1073B\n" "help.text" msgid "Open the XForms document and use the following toolbars and windows:" msgstr "Opna XForms-dokumentet og bruk desse verktøylinjene og vindauge:" #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN10741\n" "help.text" msgid "Form Design toolbar" msgstr "Verktøylinja Skjemautforming" #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN10757\n" "help.text" msgid "Form Controls toolbar" msgstr "Verktøylinja Kontrollelement for skjema" #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN1075F\n" "help.text" msgid "Data Navigator" msgstr "Datastruktur" #: xforms.xhp msgctxt "" "xforms.xhp\n" "par_idN1075B\n" "help.text" msgid "Form Navigator" msgstr "Skjemautforskar" #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "tit\n" "help.text" msgid "Working With %PRODUCTNAME XML Filters" msgstr "Arbeida med %PRODUCTNAME XML-filter" #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "bm_id7007583\n" "help.text" msgid "saving;to XML loading;XML files importing;from XML exporting;to XML file filters;XMLXSLT filters, see also XML filters" msgstr "lagra;til XML lasta inn;XML-filer importera;frå XML eksportera;til XML filfilter;XMLXSLT-filter, sjå også XML-filter" #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "par_idN10923\n" "help.text" msgid "About XML Filters " msgstr "Om XML-filtra " #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "par_idN10927\n" "help.text" msgid "%PRODUCTNAME stores documents in XML format. You can create customized filters that convert the native OpenDocument XML file format used by %PRODUCTNAME into another format. These filters can be integrated into %PRODUCTNAME seamlessly so that you can save or load these formats transparently." msgstr "%PRODUCTNAME lagrar dokument i XML-format. Du kan laga tilpassa filter som gjer om XML-filformatet OpenDocument som vert brukt av %PRODUCTNAME, til andre format. Desse filtra kan integrerast i %PRODUCTNAME, så du kan lagra eller lasta inn desse formata." #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "par_idN1093A\n" "help.text" msgid "To create an XML filter, you must have a good understanding of XML and XSLT concepts. These concepts are beyond the scope of this help." msgstr "For å laga eit XML-filter, må du ha eit godt kjennskap til XML- og XSLT-konsepta. Desse konsepta ligg utanfor omfanget av denne hjelpa." #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "par_idN1093D\n" "help.text" msgid "An XML filter contains stylesheets that are written in the XSLT language. The stylesheets define the transformation from the OpenDocument file format to another XML format through export and import filters. There are three types of XML filters:" msgstr "Eit XML-filter inneheld stilark, som er skrive i språket XSLT. Stilarket styrer omgjeringa frå OpenDocument-filformatet til eit anna XML-format gjennom eksport- og importfilter. Der er tre slag XML-filter:" #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "par_idN10947\n" "help.text" msgid "Import Filters load external XML files and transform the format of the files into the OpenDocument XML file format. After you install an import filter, the name of the filter is added to the list of file types in the File Open dialog." msgstr "Importfilter lastar inn eksterne XML-filer og gjer om filene til OpenDocument XML-filformat. Når du har installert eit importfilter, vert namnet på filteret lagt til til lista med filtypar i dialogvindauget Opna." #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "par_idN10960\n" "help.text" msgid "Export Filters transform OpenDocument XML files and save the files to a different XML format. After you install an export filter, the name of the filter is added to the list of file types in the Export dialog." msgstr "Eksportfilter gjer om OpenDocument XML-filer og lagrar filene i eit anna XML-format. Når du har installert eit eksportfilter, vert namnet på filteret lagt til lista med filtypar i dialogvindauget Eksporter ." #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "par_idN10979\n" "help.text" msgid "Import/Export Filters load and save OpenDocument XML files into a different XML format. After you install these filters, the names of the filters are added to the list of file types in the File Open dialog and the File Save As dialog." msgstr "Import/eksport-filter lastar inn og lagrar OpenDocument XML-filer i eit anna XML-format. Når du har installert desse filtra vert namna på filtera lagt til lista med filtypar i dialogvindauga Opna og Lagra som." #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "par_idN10B39\n" "help.text" msgid "World Wide Web Consortium Pages on Extensible Stylesheet Language (XSL)" msgstr "World Wide Web Consortium Pages on Extensible Stylesheet Language (XSL)" #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "par_idN10B4E\n" "help.text" msgid "World Wide Web Consortium Pages on Extensible Markup Language (XML)" msgstr "World Wide Web Consortium Pages on Extensible Markup Language (XML)" #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "par_idN10D97\n" "help.text" msgid "" msgstr "" #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "par_id5569017\n" "help.text" msgid "Distributing XML filters" msgstr "Distribuera XML-filter" #: xsltfilter.xhp msgctxt "" "xsltfilter.xhp\n" "par_id6426892\n" "help.text" msgid "Creating and Testing XML filters" msgstr "Laga og testa XML-filter" #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "tit\n" "help.text" msgid "Creating XML Filters" msgstr "Laga XML-filter" #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "bm_id7007583\n" "help.text" msgid "testing XML filtersXML filters;creating/testing" msgstr "testa XML-filterXML-filter;laga/teste" #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "hd_id1413922\n" "help.text" msgid "Creating XML Filters " msgstr "Laga XML-filter " #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN1053D\n" "help.text" msgid "Creating an XML Filter for %PRODUCTNAME" msgstr "Laga eit XML-filter for %PRODUCTNAME" #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN109A9\n" "help.text" msgid "When you create an XML filter for %PRODUCTNAME, you need to design an XSLT stylesheet that can convert to and from the OpenDocument XML file format." msgstr "Når du lagar eit XML-filter for %PRODUCTNAME, må du utforma eit XSLT-stilark som kan konvertera til og frå OpenDocument sitt XML-filformat." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN109B0\n" "help.text" msgid "For more information about the OpenDocument XML format, go to http://xml.openoffice.org/." msgstr "Du finn meir om OpenDocument XML-formatet på http://xml.openoffice.org/." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN109C5\n" "help.text" msgid "If you want, you can include a template with your filter to apply %PRODUCTNAME styles to an XML document that you import." msgstr "Viss du vil, kan du inkludera ein mal med filteret for å leggja til %PRODUCTNAME-stilar i eit XML-dokument som du importerer." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10531\n" "help.text" msgid "To Create an XML Filter" msgstr "Slik lagar du eit XML-filter" #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN109E0\n" "help.text" msgid "Create an XSLT transformation stylesheet that maps the elements of the external XML format to the elements of the OpenDocument XML file format and back again." msgstr "Lag eit stilark for XSLT-transformering som kan tilordna elementa i det eksterne XML-formatet til elementa i OpenDocument-filformat og tilbake igjen." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN109E8\n" "help.text" msgid "Create a template that assigns %PRODUCTNAME styles to elements in the external XML format when you import a file in this format into %PRODUCTNAME." msgstr "Lag ein mal som tildeler %PRODUCTNAME-stilar til element i det eksterne XML-formatet når du importerer ei fil i dette formatet til %PRODUCTNAME" #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN109EC\n" "help.text" msgid "In %PRODUCTNAME Writer, create a text document, and choose Tools - XML Filter Settings." msgstr "Lag eit tekstdokument i %PRODUCTNAME Writer og vel Verktøy → Innstillingar for XML-filter." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN109F4\n" "help.text" msgid "Click New." msgstr "Trykk OK." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN109FC\n" "help.text" msgid "In the XML Filter dialog, click the General tab, and define the properties of the filter." msgstr "Klikk på fana Generelt i dialogvindauget XML-filter og definer eigenskapane for filteret." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A03\n" "help.text" msgid "In the Filter Name box, enter a name for the XML filter." msgstr "Skrive inn eit namn for XML-filteret i feltet Filternamn " #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10CA1\n" "help.text" msgid "This name is displayed in the XML Filter Settings dialog." msgstr "Dette namnet vert vist i dialogvindauget Innstillingar for XML-filter." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A09\n" "help.text" msgid "In the Application box, select the %PRODUCTNAME application that the filter is for." msgstr "I feltet Program-boksen vel du det %PRODUCTNAME-programmet som filteret gjeld for." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A0F\n" "help.text" msgid "In the Name of File Type box, enter the file type that the filter is for." msgstr "Skriv inn filtypen som filteret gjeld for i feltet Namn på filtype.." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10CC6\n" "help.text" msgid "This name is displayed in the list of file types in the Open, Export, and Save As dialogs." msgstr "Dette namnet vert vist i lista over filtypar i dialogvindauga Opna, Eksporter og Lagra som." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A15\n" "help.text" msgid "In the File extension box, enter the extension for the exported file." msgstr "Skriv inn filetternamnet for den eksporterte fila i feltet Filetternamn." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A1B\n" "help.text" msgid "To differentiate the file from other XML files, enter an extension other than *.xml." msgstr "For å skilja fila frå andre XML-filer, kan du skriva inn eit filetternamn som ikkje er *.xml." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A1F\n" "help.text" msgid "On the Transformation tab page, define the transformation properties for the filter." msgstr "Vel omgjeringseigenskapane for filteret på fana Omgjering." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A26\n" "help.text" msgid "(Optional) In the DocType box, enter the document type identifier for the external file format." msgstr "(Valfri) I DocType-feltet kan du skriva inn dokumenttypeidentifikatoren for det eksterne filformatet." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10D0E\n" "help.text" msgid "This identifier is used to detect the file type on import." msgstr "Denne identifikatoren vert brukt til å finna filtypen ved import." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A32\n" "help.text" msgid "In the XSLT for export box, enter the path and file name of the XSLT stylesheet that defines the transformation from OpenDocument format to the external format." msgstr "Skriv inn i feltet XSLT til eksport stien og filnamnet for XSLT-stilarket som definerer omgjeringa frå OpenDocument-formatet til det eksterne formatet." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A38\n" "help.text" msgid "In the XSLT for import box, enter the path and file name to the XSLT stylesheet that defines the transformation from the external format to OpenDocument format." msgstr "Skriv inn i feltet XSLT til import stien og filnamnet for XSLT-stilarket som definerer omgjeringa frå det eksterne filformatet til OpenDocument-formatet. " #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A3E\n" "help.text" msgid "(Optional) In the Template for import box, enter the path and name of the template that defines the %PRODUCTNAME styles that are used in the imported file." msgstr "(Valfri) Skriv inn i feltet Mal til import sti og namn på malen som definerer %PRODUCTNAME-stilene som vert brukt i den importerte fila." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A44\n" "help.text" msgid "The files that are specified on the Transformation tab page are copied to the local %PRODUCTNAME users directory." msgstr "Filene som er spesifisert på fana Omgjering er kopiert til den lokale %PRODUCTNAME-brukarmappa." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A4C\n" "help.text" msgid "Click OK." msgstr "Trykk OK." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A56\n" "help.text" msgid "To Test an XML Filter" msgstr "Slik testar du eit XML-filter" #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A5A\n" "help.text" msgid "You can perform basic tests on a custom XML filter in %PRODUCTNAME." msgstr "Du kan utføra grunnleggjande testar av eit tilpassa XML-filter i %PRODUCTNAME." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A91\n" "help.text" msgid "The document is not altered by these tests." msgstr "Dokumentet vert ikkje endra av desse testane." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A60\n" "help.text" msgid "Create or open a text document." msgstr "Laga eller opna eit tekstdokument." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A67\n" "help.text" msgid "Choose Tools - XML Filter Settings." msgstr "Vel Verktøy → Innstillingar for XML-filter." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A6F\n" "help.text" msgid "In the list of filters, select the filter that you want to test, and click Test XSLTs." msgstr "Vel filteret som du vil testa i lista over filter og klikk på Test XSLT-ar." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A82\n" "help.text" msgid "To test an Export Filter, do one of the following in the Export area of the dialog:" msgstr "For å testa eit Eksportfilter, gjer eitt av dei følgjande i området Eksporter i dialogvindauget:" #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10DEB\n" "help.text" msgid "Click Browse, select the %PRODUCTNAME document that you want to test, and click Open." msgstr "Klikk på Bla gjennom og vel %PRODUCTNAME-dokumentet som du vil testa og klikk på Opna." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10DF7\n" "help.text" msgid "To test the current document, click Current Document." msgstr "For å testa det gjeldande dokumentet, klikk på Dette dokumentet." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_idN10A99\n" "help.text" msgid "To test an Import Filter, click Browse in the Import area of the dialog, select a document, and click Open." msgstr "For å testa eit Importfilter klikkar du på Bla gjennom i området Importer i dialogvindauget, merker eit dokument og klikkar på Opna." #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_id8579668\n" "help.text" msgid "About XML Filters" msgstr "Om XML-filtera" #: xsltfilter_create.xhp msgctxt "" "xsltfilter_create.xhp\n" "par_id5569017\n" "help.text" msgid "Distributing XML filters" msgstr "Distribuera XML-filtera" #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "tit\n" "help.text" msgid "Distributing an XML filter as package" msgstr "Distribuera eit XML-filter som ei pakke" #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "bm_id7007583\n" "help.text" msgid "distributing XML filtersdeleting;XML filtersXML filters;saving as package/installing/deletinginstalling;XML filters" msgstr "distribuera XML filtersletta;XML-filterXML-filter;lagra som pakke/installera/slettainstallering;XML-filter" #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_idN10ABC\n" "help.text" msgid "Distributing An XML Filter As Package " msgstr "Distribuera eit XML-filter som ei pakke " #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_idN10AC0\n" "help.text" msgid "You can distribute an XML filter to multiple users using a special package format." msgstr "Du kan distribuera eit XML-filter til fleire brukarar ved å bruka eit spesielt pakkeformat." #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_idN10AC3\n" "help.text" msgid "To Save an XML Filter as a Package" msgstr "Slik lagrar du eit XML-fileter som ei pakke" #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_idN10ACD\n" "help.text" msgid "The XML Filter Settings dialog is only available when a text document is open." msgstr "Dialogvindauget «Innstillingar for XML-filter» er berre tilgjengeleg når eit tekstdokument er ope." #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_idN10ACA\n" "help.text" msgid "In Writer, choose Tools - XML Filter Settings." msgstr "I Writer, vel Verktøy → Innstillingar for XML-filter." #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_idN10AD9\n" "help.text" msgid "Select the filter that you want to distribute and click Save As Package." msgstr "Merk filteret som du vil distribuera og klikk på Lagra som pakke." #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_idN10AE0\n" "help.text" msgid "To Install an XML Filter from a Package" msgstr "Slik installerer du eit XML-filter frå ei pakke:" #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_idN10AEA\n" "help.text" msgid "The XML Filter Settings dialog is only available when a text document is opened." msgstr "Dialogvindauget «Innstillingar for XML-filter» er berre tilgjengeleg når eit tekstdokument er ope. " #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_idN10AE7\n" "help.text" msgid "In Writer, choose Tools - XML Filter Settings." msgstr "I Writer, vel Verktøy → Innstillingar for XML-filter." #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_idN10AF6\n" "help.text" msgid "Click Open Package and select the package file with the filter you want to install." msgstr "Klikk på Opna pakke og merk pakkefila med det filteret du vil installera." #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_idN10535\n" "help.text" msgid "To Delete an Installed XML Filter" msgstr "Slik fjernar du eit installert XML-filter:" #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_idN10B0A\n" "help.text" msgid "In Writer, choose Tools - XML Filter Settings." msgstr "I Writer, vel Verktøy → Innstillingar for XML-filter." #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_idN10B19\n" "help.text" msgid "Select the filter you want to delete and click Delete." msgstr "Merk filteret du vil sletta og trykk på Slett." #: xsltfilter_distribute.xhp msgctxt "" "xsltfilter_distribute.xhp\n" "par_id6011841\n" "help.text" msgid "About XML Filters" msgstr "Om XML-filtera"